KEGG   Homo sapiens (human): 64223Help
Entry
64223             CDS       T01001                                 

Gene name
MLST8, GBL, GbetaL, LST8, POP3, WAT1
Definition
(RefSeq) MTOR associated protein, LST8 homolog
  KO
K08266  target of rapamycin complex subunit LST8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    64223 (MLST8)
   04150 mTOR signaling pathway
    64223 (MLST8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64223 (MLST8)
   04136 Autophagy - other
    64223 (MLST8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    64223 (MLST8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64223 (MLST8)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    64223 (MLST8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Hira Frtz
Motif
Other DBs
NCBI-GeneID: 64223
NCBI-ProteinID: NP_001186102
OMIM: 612190
HGNC: 24825
Ensembl: ENSG00000167965
Vega: OTTHUMG00000128827
Pharos: Q9BVC4(Tbio)
UniProt: Q9BVC4
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 326 aa AA seqDB search
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctccccaggcacggtgggcagtgacccggtcatcctggccactgcaggctac
gaccacaccgtgcgcttctggcaggcccacagcggcatctgcacccggacggtgcagcac
caggactcccaggtgaatgccttggaggtcacaccggaccgcagcatgattgctgctgca
ggttaccagcacatccgcatgtatgatctcaactccaataaccctaaccccatcatcagc
tacgacggcgtcaacaagaacatcgcgtctgtgggcttccacgaagacggccgctggatg
tacacgggcggcgaggactgcacagccaggatctgggacctcaggtcccggaacctgcag
tgccagcggatcttccaggtgaacgcacccattaactgcgtgtgcctgcaccccaaccag
gcagagctcatcgtgggtgaccagagcggggctatccacatctgggacttgaaaacagac
cacaacgagcagctgatccctgagcccgaggtctccatcacgtccgcccacatcgatccc
gacgccagctacatggcagctgtcaatagcaccggaaactgctatgtctggaatctgacg
gggggcattggtgacgaggtgacccagctcatccccaagactaagatccctgcccacacg
cgctacgccctgcagtgtcgcttcagccccgactccacgctcctcgccacctgctcggct
gatcagacgtgcaagatctggaggacgtccaacttctccctgatgacggagctgagcatc
aagagcggcaaccccggggagtcctcccgcggctggatgtggggctgcgccttctcgggg
gactcccagtacatcgtcactgcttcctcggacaacctggcccggctctggtgtgtggag
actggagagatcaagagagagtatggcggccaccagaaggctgttgtctgcctggccttc
aatgacagtgtgctgggctag

DBGET integrated database retrieval system