KEGG   Homo sapiens (human): 64232Help
Entry
64232             CDS       T01001                                 

Gene name
MS4A5, CD20-L2, CD20L2, TETM4
Definition
(RefSeq) membrane spanning 4-domains A5
  KO
K22191  membrane-spanning 4-domains subfamily A member 5/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    64232 (MS4A5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   64232 (MS4A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20
Motif
Other DBs
NCBI-GeneID: 64232
NCBI-ProteinID: NP_076434
OMIM: 606499
HGNC: 13374
Ensembl: ENSG00000166930
Vega: OTTHUMG00000167613
Pharos: Q9H3V2(Tdark)
UniProt: Q9H3V2
LinkDB All DBs
Position
11q12.2
AA seq 200 aa AA seqDB search
MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIM
TFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIM
NFLSALGAIAGIILLTFGFILDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFI
SLPFSILGCHSEDCDCEQCC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggattcaagcaccgcacacagtccggtgtttctggtatttcctccagaaatcactgct
tcagaatatgagtccacagaactttcagccacgaccttttcaactcaaagccccttgcaa
aaattatttgctagaaaaatgaaaatcttagggactatccagatcctgtttggaattatg
accttttcttttggagttatcttccttttcaccttgttaaaaccatatccaaggtttccc
tttatatttctttcaggatatccattctggggctctgttttgttcattaattctggagcc
ttcctaattgcagtgaaaagaaaaaccacagaaactctgataatattgagccgaataatg
aattttcttagtgccctgggagcaatagctggaatcattctcctcacatttggtttcatc
ctagatcaaaactacatttgtggttattctcaccaaaatagtcagtgtaaggctgttact
gtcctgttcttgggaattttgattacattgatgactttcagcattattgaattattcatt
tctctgcctttctcaattttggggtgccactcagaggattgtgattgtgaacaatgttgt
tga

DBGET integrated database retrieval system