KEGG   Homo sapiens (human): 64240
Entry
64240             CDS       T01001                                 

Gene name
ABCG5, STSL, STSL2
Definition
(RefSeq) ATP binding cassette subfamily G member 5
  KO
K05683  ATP-binding cassette, subfamily G (WHITE), member 5 (sterolin 1)
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04975  Fat digestion and absorption
hsa04976  Bile secretion
hsa04979  Cholesterol metabolism
Disease
H00152  Sitosterolemia
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    64240 (ABCG5)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    64240 (ABCG5)
   04975 Fat digestion and absorption
    64240 (ABCG5)
   04979 Cholesterol metabolism
    64240 (ABCG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    64240 (ABCG5)
Transporters [BR:hsa02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG5, 8 subgroups
    64240 (ABCG5)
SSDB
Motif
Pfam: ABC_tran ABC2_membrane ABC2_membrane_7 AAA_21 AAA_29 AAA_23 AAA_16 SMC_N RsgA_GTPase NACHT MobB AAA_22 AAA_30 AAA_33 AAA_28 MeaB
Other DBs
NCBI-GeneID: 64240
NCBI-ProteinID: NP_071881
OMIM: 605459
HGNC: 13886
Ensembl: ENSG00000138075
Vega: OTTHUMG00000128758
Pharos: Q9H222(Tbio)
UniProt: Q9H222
LinkDB
Structure
PDB: 
5DO7

Position
2p21
AA seq 651 aa
MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSC
RQQWTRQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGRLGRAGTFLGEVYVNGRAL
RREQFQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQKKVEAVMAELSLSHV
ADRLIGNYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELAR
RNRIVVLTIHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDF
YMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKD
SPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRV
GLLYQFVGATPYTGMLNAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATM
IFSSVCYWTLGLHPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIA
GVLVGSGFLRNIQEMPIPFKIISYFTFQKYCSEILVVNEFYGLNFTCGSSNVSVTTNPMC
AFTQGIQFIEKTCPGATSRFTMNFLILYSFIPALVILGIVVFKIRDHLISR
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgggtgacctctcatctttgacccccggagggtccatgggtctccaagtaaacagaggc
tcccagagctccctggagggggctcctgccaccgccccggagcctcacagcctgggcatc
ctccatgcctcctacagcgtcagccaccgcgtgaggccctggtgggacatcacatcttgc
cggcagcagtggaccaggcagatcctcaaagatgtctccttgtacgtggagagcgggcag
atcatgtgcatcctaggaagctcaggctccgggaaaaccacgctgctggacgccatgtcc
gggaggctggggcgcgcggggaccttcctgggggaggtgtatgtgaacggccgggcgctg
cgccgggagcagttccaggactgcttctcctacgtcctgcagagcgacaccctgctgagc
agcctcaccgtgcgcgagacgctgcactacaccgcgctgctggccatccgccgcggcaat
cccggctccttccagaagaaggtggaggccgtcatggcagagctgagtctgagccatgtg
gcagaccgactgattggcaactacagcttggggggcatttccacgggtgagcggcgccgg
gtctccatcgcagcccagctgctccaggatcctaaggtcatgctgtttgatgagccaacc
acaggcctggactgcatgactgctaatcagattgtcgtcctcctggtggaactggctcgc
aggaaccgaattgtggttctcaccattcaccagccccgttctgagctttttcagctcttt
gacaaaattgccatcctgagcttcggagagctgattttctgtggcacgccagcggaaatg
cttgatttcttcaatgactgcggttacccttgtcctgaacattcaaacccttttgacttc
tatatggacctgacgtcagtggatacccaaagcaaggaacgggaaatagaaacctccaag
agagtccagatgatagaatctgcctacaagaaatcagcaatttgtcataaaactttgaag
aatattgaaagaatgaaacacctgaaaacgttaccaatggttcctttcaaaaccaaagat
tctcctggagttttctctaaactgggtgttctcctgaggagagtgacaagaaacttggtg
agaaataagctggcagtgattacgcgtctccttcagaatctgatcatgggtttgttcctc
cttttcttcgttctgcgggtccgaagcaatgtgctaaagggtgctatccaggaccgcgta
ggtctcctttaccagtttgtgggcgccaccccgtacacaggcatgctgaacgctgtgaat
ctgtttcccgtgctgcgagctgtcagcgaccaggagagtcaggacggcctctaccagaag
tggcagatgatgctggcctatgcactgcacgtcctccccttcagcgttgttgccaccatg
attttcagcagtgtgtgctactggacgctgggcttacatcctgaggttgcccgatttgga
tatttttctgctgctctcttggccccccacttaattggtgaatttctaactcttgtgcta
cttggtatcgtccaaaatccaaatatagtcaacagtgtagtggctctgctgtccattgcg
ggggtgcttgttggatctggattcctcagaaacatacaagaaatgcccattccttttaaa
atcatcagttattttacattccaaaaatattgcagtgagattcttgtagtcaatgagttc
tacggactgaatttcacttgtggcagctcaaatgtttctgtgacaactaatccaatgtgt
gccttcactcaaggaattcaattcattgagaaaacctgcccaggtgcaacatctagattc
acaatgaactttctgattttgtattcatttattccagctcttgtcatcctaggaatagtt
gttttcaaaataagggatcatctcattagcaggtag

DBGET integrated database retrieval system