KEGG   Homo sapiens (human): 6426
Entry
6426              CDS       T01001                                 

Gene name
SRSF1, ASF, SF2, SF2p33, SFRS1, SRp30a
Definition
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  splicing factor, arginine/serine-rich 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04657  IL-17 signaling pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6426 (SRSF1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6426 (SRSF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6426 (SRSF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6426 (SRSF1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6426 (SRSF1)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Nup35_RRM_2 DDE_Tnp_1 RRM_7 CoV_nucleocap PRP38_assoc
Other DBs
NCBI-GeneID: 6426
NCBI-ProteinID: NP_008855
OMIM: 600812
HGNC: 10780
Ensembl: ENSG00000136450
Vega: OTTHUMG00000178781
Pharos: Q07955(Tbio)
UniProt: Q07955
LinkDB
Structure
PDB: 

Position
17q22
AA seq 248 aa
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcgggaggtggtgtgattcgtggccccgcagggaacaacgattgccgcatctacgtg
ggtaacttacctccagacatccgaaccaaggacattgaggacgtgttctacaaatacggc
gctatccgcgacatcgacctcaagaatcgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagacgcggtgtatggtcgcgacggctatgattacgat
gggtaccgtctgcgggtggagtttcctcgaagcggccgtggaacaggccgaggcggcggc
gggggtggaggtggcggagctccccgaggtcgctatggccccccatccaggcggtctgaa
aacagagtggttgtctctggactgcctccaagtggaagttggcaggatttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacctatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

DBGET integrated database retrieval system