KEGG   Homo sapiens (human): 643Help
Entry
643               CDS       T01001                                 

Gene name
CXCR5, BLR1, CD185, MDR15
Definition
(RefSeq) C-X-C motif chemokine receptor 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    643 (CXCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    643 (CXCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    643 (CXCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    643 (CXCR5)
   04050 Cytokine receptors [BR:hsa04050]
    643 (CXCR5)
   04090 CD molecules [BR:hsa04090]
    643 (CXCR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    643 (CXCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   643 (CXCR5)
CD molecules [BR:hsa04090]
 Proteins
  643 (CXCR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw TctB
Motif
Other DBs
NCBI-GeneID: 643
NCBI-ProteinID: NP_001707
OMIM: 601613
HGNC: 1060
Ensembl: ENSG00000160683
Vega: OTTHUMG00000166345
Pharos: P32302(Tbio)
UniProt: P32302 A0N0R2 A8K647 Q2YD84
LinkDB All DBs
Position
11q23.3
AA seq 372 aa AA seqDB search
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL
IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF
LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL
ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG
VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL
PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL
SESENATSLTTF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaactacccgctaacgctggaaatggacctcgagaacctggaggacctgttctgggaa
ctggacagattggacaactataacgacacctccctggtggaaaatcatctctgccctgcc
acagaggggcccctcatggcctccttcaaggccgtgttcgtgcccgtggcctacagcctc
atcttcctcctgggcgtgatcggcaacgtcctggtgctggtgatcctggagcggcaccgg
cagacacgcagttccacggagaccttcctgttccacctggccgtggccgacctcctgctg
gtcttcatcttgccctttgccgtggccgagggctctgtgggctgggtcctggggaccttc
ctctgcaaaactgtgattgccctgcacaaagtcaacttctactgcagcagcctgctcctg
gcctgcatcgccgtggaccgctacctggccattgtccacgccgtccatgcctaccgccac
cgccgcctcctctccatccacatcacctgtgggaccatctggctggtgggcttcctcctt
gccttgccagagattctcttcgccaaagtcagccaaggccatcacaacaactccctgcca
cgttgcaccttctcccaagagaaccaagcagaaacgcatgcctggttcacctcccgattc
ctctaccatgtggcgggattcctgctgcccatgctggtgatgggctggtgctacgtgggg
gtagtgcacaggttgcgccaggcccagcggcgccctcagcggcagaaggcagtcagggtg
gccatcctggtgacaagcatcttcttcctctgctggtcaccctaccacatcgtcatcttc
ctggacaccctggcgaggctgaaggccgtggacaatacctgcaagctgaatggctctctc
cccgtggccatcaccatgtgtgagttcctgggcctggcccactgctgcctcaaccccatg
ctctacactttcgccggcgtgaagttccgcagtgacctgtcgcggctcctgacgaagctg
ggctgtaccggccctgcctccctgtgccagctcttccctagctggcgcaggagcagtctc
tctgagtcagagaatgccacctctctcaccacgttctag

DBGET integrated database retrieval system