KEGG   Homo sapiens (human): 64343
Entry
64343             CDS       T01001                                 

Gene name
AZI2, AZ2, NAP1, TILP
Definition
(RefSeq) 5-azacytidine induced 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Network
nt06133  RLR signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06263  Hepatocellular carcinoma
  Element
N00469  RIG-I-IRF7/3 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    64343 (AZI2)
SSDB
Motif
Pfam: TBD Cnn_1N
Other DBs
NCBI-GeneID: 64343
NCBI-ProteinID: NP_071906
OMIM: 609916
HGNC: 24002
Ensembl: ENSG00000163512
Vega: OTTHUMG00000130573
Pharos: Q9H6S1(Tdark)
UniProt: Q9H6S1
LinkDB
Structure
PDB: 
5EP6 5Z7L 5Z7G

Position
3p24.1
AA seq 392 aa
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSES
LKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMR
KECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQ
AELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLLPNGKALCHTTS
SPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSET
AFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggatgcactggtagaagatgatatctgtattctgaatcatgaaaaagcccataagaga
gatacagtgactccagtttcaatatattcaggagatgaatctgttgcttcccattttgct
cttgtcactgcatatgaagacatcaaaaaacgacttaaggattcagagaaagagaactct
ttgttaaagaagagaataagatttttggaagaaaagctaatagctcgatttgaagaagaa
acaagttccgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtttgc
attgatagagataatttgaagagcaaactggacaaaatgaataaagacaactctgaatct
ttgaaagtattgaatgagcagctacaatctaaagaagtagaactcctccagctgaggaca
gaggtggaaactcagcaggtgatgaggaatttaaatccaccttcatcaaactgggaggtg
gaaaagttgagctgtgacctgaagatccatggtttggaacaagagctggaactgatgagg
aaagaatgtagcgatctcaaaatagaactacagaaagccaaacaaacggatccatatcag
gaagacaatctgaagagcagagatctccaaaaactaagcatttcaagtgataatatgcag
catgcatactgggaactgaagagagaaatgtctaatttacatctggtgactcaagtacaa
gctgaactactaagaaaactgaaaacctcaactgcaatcaagaaagcctgtgcccctgta
ggatgcagtgaagaccttggaagagacagcacaaaactgcacttgatgaattttactgca
acatacacaagacatccccctctcttaccaaatggcaaagctctttgtcataccacatct
tcccctttaccaggagatgtaaaggttttatcagagaaagcaatcctccaatcatggaca
gacaatgagagatccattcctaatgatggtacatgctttcaggaacacagttcttatggc
agaaattctctggaagacaattcctgggtatttccaagtcctcctaaatcaagtgagaca
gcatttggggaaactaaaactaaaactttgcctttacccaaccttccaccactgcattac
ttggatcaacataatcagaactgcctttataagaattaa

DBGET integrated database retrieval system