KEGG   Homo sapiens (human): 64399Help
Entry
64399             CDS       T01001                                 

Gene name
HHIP, HIP
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64399 (HHIP)
   04024 cAMP signaling pathway
    64399 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64399 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    64399 (HHIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_rec GSDH EGF_2
Motif
Other DBs
NCBI-GeneID: 64399
NCBI-ProteinID: NP_071920
OMIM: 606178
HGNC: 14866
Ensembl: ENSG00000164161
Vega: OTTHUMG00000161428
Pharos: Q96QV1(Tbio)
UniProt: Q96QV1
LinkDB All DBs
Structure
PDB: 

Position
4q31.21
AA seq 700 aa AA seqDB search
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQ
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctgctgctggccgtggctctgggcttctttgaa
ggagatgctaagtttggggaaagaaacgaagggagcggagcaaggaggagaaggtgcctg
aatgggaaccccccgaagcgcctgaaaaggagagacaggaggatgatgtcccagctggag
ctgctgagtgggggagagatgctgtgcggtggcttctaccctcggctgtcctgctgcctg
cggagtgacagcccggggctagggcgcctggagaataagatattttctgttaccaacaac
acagaatgtgggaagttactggaggaaatcaaatgtgcactttgctctccacattctcaa
agcctgttccactcacctgagagagaagtcttggaaagagacctagtacttcctctgctc
tgcaaagactattgcaaagaattcttttacacttgccgaggccatattccaggtttcctt
caaacaactgcggatgagttttgcttttactatgcaagaaaagatggtgggttgtgcttt
ccagattttccaagaaaacaagtcagaggaccagcatctaactacttggaccagatggaa
gaatatgacaaagtggaagagatcagcagaaagcacaaacacaactgcttctgtattcag
gaggttgtgagtgggctgcggcagcccgttggtgccctgcatagtggggatggctcgcaa
cgtctcttcattctggaaaaagaaggttatgtgaagatacttacccctgaaggagaaatt
ttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaagaggactgctaagcctcgcattccatcccaattacaagaaaaatggaaagttgtat
gtgtcctataccaccaaccaagaacggtgggctatcgggcctcatgaccacattcttagg
gttgtggaatacacagtatccagaaaaaatccacaccaagttgatttgagaacagccaga
gtctttcttgaagttgcagaactccacagaaagcatctgggaggacaactgctctttggc
cctgacggctttttgtacatcattcttggtgatgggatgattacactggatgatatggaa
gaaatggatgggttaagtgatttcacaggctcagtgctacggctggatgtggacacagac
atgtgcaacgtgccttattccataccaaggagcaacccacacttcaacagcaccaaccag
ccccccgaagtgtttgctcatgggctccacgatccaggcagatgtgctgtggatagacat
cccactgatataaacatcaatttaacgatactgtgttcagactccaatggaaaaaacaga
tcatcagccagaattctacagataataaaggggaaagattatgaaagtgagccatcactt
ttagaattcaagccattcagtaatggtcctttggttggtggatttgtataccggggctgc
cagtcagaaagattgtatggaagctacgtgtttggagatcgtaatgggaatttcctaact
ctccagcaaagtcctgtgacaaagcagtggcaagaaaaaccactctgtctcggcactagt
gggtcctgtagaggctacttttccggtcacatcttgggatttggagaagatgaactaggt
gaagtttacattttatcaagcagtaaaagtatgacccagactcacaatggaaaactctac
aaaattgtagatcccaaaagacctttaatgcctgaggaatgcagagccacggtacaacct
gcacagacactgacttcagagtgctccaggctctgtcgaaacggctactgcacccccacg
ggaaagtgctgctgcagtccaggctgggagggggacttctgcagaactgcaaaatgtgag
ccagcatgtcgtcatggaggtgtctgtgttagaccgaacaagtgcctctgtaaaaaagga
tatcttggtcctcaatgtgaacaagtggacagaaacatccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttacttgctggatctaacaagttacattgta
tag

DBGET integrated database retrieval system