KEGG   Homo sapiens (human): 64411Help
Entry
64411             CDS       T01001                                 

Gene name
ARAP3, CENTD3, DRAG1
Definition
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64411 (ARAP3)
   04024 cAMP signaling pathway
    64411 (ARAP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64411 (ARAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64411 (ARAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    64411 (ARAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    64411 (ARAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH ArfGap RA SAM_2 SAM_1 PH_8 PH_3 PH_6 PH_2
Motif
Other DBs
NCBI-GeneID: 64411
NCBI-ProteinID: NP_071926
OMIM: 606647
HGNC: 24097
Ensembl: ENSG00000120318
Vega: OTTHUMG00000129610
Pharos: Q8WWN8(Tbio)
UniProt: Q8WWN8 Q05CH1 Q9H7C1
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 1544 aa AA seqDB search
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGL
LPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccctcaggacctggacatcgctgtgtggctggccacggtgcacctggagcag
tatgcagacacgttccgacggcatggcctggctacagcaggtgcagcccggggcctgggc
cacgaggagttgaagcagttgggcatcagcgccacagggcaccggaaacgcattctacgc
ctgctacagacaggcaccgaagagggctccctggatcccaaatcagatagtgccatggaa
ccatcccccagcccagccccgcaagcccagccccctaagcccgtgccgaagcccaggacc
gtgtttggtggactcagtggccctgccaccactcagagacctgggctgagcccagccctc
gggggaccaggagtgtccaggagcccagagcccagcccaaggcctcctcctctccccact
tcctcctctgagcagtcttcagccctaaatactgtggagatgatgcctaattccatctac
ttcggcctggactcaagaggcagggcacaggcagctcaggacaaggccccagacagctcc
caaatctctgcccccacccctgccctcaggcccacaacaggcacagtgcacatcatggat
cctggttgcctgtactatggtgtccaacctgtggggactccaggagcccccgacagaaga
gagagcagaggtgtttgtcagggcagggctgaacacaggctcagcagacaggatctggag
gcacgggaggatgctggctatgccagccttgagctacctggagactccaccctcttatcg
cccaccctggaaacagaggagaccagtgatgacctcatttcaccctatgccagcttctcc
ttcacggcagaccgcctcacgcccctgctcagtggctggctagacaagctctcccctcag
ggaaactatgtcttccagagacgctttgtgcagttcaatgggaggagtctgatgtacttt
ggcagtgacaaggaccccttccctaagggtgtgatacctttgactgccattgagatgacc
cgcagcagcaaggacaacaagttccaggtcatcaccggccagagggtgttcgtgttccgc
acagagagcgaggctcagcgggacatgtggtgctccacgctgcagtcctgtctgaaggag
cagcgcctcctgggccacccccggcccccccaaccaccccgacccctccgcacgggcatg
ctggagctgcgtggacacaaggccaaggtgtttgctgccttgagccctggagagctggca
ctgtacaagagtgagcaggccttctctctgggcatcgggatctgcttcatcgaactgcag
ggctgcagcgtccgggagaccaagagtcgaagctttgacctgctcacaccccatcgctgc
ttcagcttcacagccgagtctgggggtgctcggcagagctgggcggccgctctgcaggaa
gcagtaaccgagaccctgtctgactacgaggtggctgagaagatctggtctaatcgggcc
aaccggcagtgtgcggactgtgggtcctcccgcccagattgggctgctgtcaatttgggg
gtggtcatctgcaagcagtgtgcaggtcagcaccgggccctgggttctgggatctccaag
gtgcagagcctgaagctggacacgagtgtctggagtaatgagatagtacagttattcatt
gtcctgggaaatgatcgtgccaaccgcttctgggcagggaccctacccccaggtgaggga
ctacatccagatgcgacccctggcccccggggagagttcatctcccgaaagtaccgtctg
ggtctcttccggaagccccaccctcagtacccagatcatagccagcttctccaggcactg
tgtgcagctgtggcaagacccaacctgctgaagaacatgacccagctcctctgtgttgag
gcctttgaaggcgaggagccctggttccccccagcccctgatggcagctgccctggcctc
ttgccctcagacccctcccctggtgtgtacaatgaggtggtggtgcgtgctacttacagc
ggcttcctgtactgcagtcccgtcagcaacaaagctggaccctcaccccctcgcaggggc
cgggatgctcccccgcgcctttggtgtgtgctgggagcagctctggaaatgtttgcatcg
gaaaacagccctgaacccctcagcctcatacagccccaggatattgtatgtctgggtgtg
agccccccacccactgacccaggtgacaggttccccttttcctttgagctcatcctcgct
ggggggaggatccagcattttggcacagatggagctgacagtctggaggcctggactagt
gctgtgggcaagtggttctccccgctgagctgccaccagctgctgggccccgggctgctg
cggctgggccgcctatggctgcggtccccctcccatacagccccggcccctggtctctgg
ctgtcagggtttggcctccttcgtggtgaccacctcttcctgtgctcagcgccgggccca
ggccccccagcccctgaggacatggtgcatctgcggcggctacaggagatcagtgtggtt
tctgcagctgacaccccagataagaaagagcatttggtcctggtggagacaggaaggacc
ctgtatctgcaaggagagggccggctggacttcacggcatggaacgcagccattgggggc
gcggctggtgggggcggcacagggctgcaggagcagcagatgagccggggtgacatcccc
atcatcgtggatgcctgcatcagttttgttacccagcatgggctccggctggaaggtgta
taccggaaagggggcgctcgtgcccgcagcctgagactcctggctgagttccgtcgggat
gcccggtcggtgaagctccgaccaggggagcactttgtggaggatgtcactgacacactc
aaacgcttctttcgtgagctcgatgaccctgtgacctctgcacggttgctgcctcgctgg
agggaggctgctgagctgccccagaagaatcagcgcctggagaaatataaagatgtgatt
ggctgcctgccgcgggtcaaccgccgcacactggccaccctcattgggcatctctatcgg
gtgcagaaatgtgcggctctaaaccagatgtgcacgcggaacttggctctgctgtttgca
cccagcgtgttccagacggatgggcgaggggagcacgaggtgcgagtgctgcaagagctc
attgatggctacatctctgtctttgatatcgattctgaccaggtagctcagattgacttg
gaggtcagtcttatcaccacctggaaggacgtgcagctgtctcaggctggagacctcatc
atggaagtttatatagagcagcagctcccagacaactgtgtcaccctgaaggtgtcccca
accctgactgctgaggagctgactaaccaggtactggagatgcgggggacagcagctggg
atggacttgtgggtgacttttgagattcgcgagcatggggagctggagcggccactgcat
cccaaggaaaaggtcttagagcaggctttacaatggtgccagctcccagagccctgctca
gcttccctgctcttgaaaaaagtccccctggcccaagctggctgcctcttcacaggtatc
cgacgtgagagcccacgggtggggctgttgcggtgtcgtgaggagccacctcgcttgctg
ggaagccgcttccaggagaggttctttctgctgcgtggccgctgcctgctgctgctcaag
gagaagaaaagctctaaaccagaacgggagtggcctttggaaggtgccaaggtctacctg
ggaatccgcaagaagttaaagcccccaacaccgtggggcttcacattgatactagagaag
atgcacctctacttgtcctgcactgacgaggatgaaatgtgggattggaccaccagcatc
cttaaagcccagcacgatgaccagcagccagtggtcttacgacgccattcctcctctgac
cttgcccgtcagaagtttggcactatgcctttgctgcctatccgtggggatgacagtgga
gccaccctcctctctgccaatcagaccctgcggcgactacacaaccggaggaccctgtcc
atgttctttccaatgaagtcatcccaggggtctgtggaggagcaagaggagctggaggag
cctgtgtacgaggagccagtgtatgaggaagtaggggccttccctgagttgatccaggac
acttctacctccttctccaccacacgggagtggacagtgaagccagagaaccccctcacc
agccagaagtcattggatcaaccctttctctccaagtcaagcacccttggccaggaggag
aggccacctgagccccctccaggccccccttcaaagagcagtccccaggcacgggggtcc
ctagaggaacagctgctccaggagctcagcagcctcatcctgaggaaaggagagaccact
gcaggcctgggaagtccttcccagccatccagcccccaatcccccagccccactggcctt
ccaacacagacacctggcttccccacccaacccccatgcacttccagtccaccctccagc
cagcccctcacatga

DBGET integrated database retrieval system