KEGG   Homo sapiens (human): 646915Help
Entry
646915            CDS       T01001                                 

Gene name
ZNF806
Definition
(RefSeq) zinc finger protein 806
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    646915 (ZNF806)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    646915 (ZNF806)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    646915 (ZNF806)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 KRAB zf-C2H2 zf-C2H2_4 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 646915
NCBI-ProteinID: NP_001291378
HGNC: 33228
Pharos: P0C7X5(Tdark)
UniProt: P0C7X5
LinkDB All DBs
Position
2q21.2
AA seq 589 aa AA seqDB search
MIKFQERVTFKDIAVIFTKEELAVLDKAQINLYQDVMLENFRNFISVDGIKNNILNLQGK
GLIYLSQEELHCWKIWKQRIRDLSVSQDYIMNLQEQCSPHLEDVSLCEEWAGMSLQISEN
ENYVVNAIIKNQDITAWQSLTQVLTPESWRKANIMTEPQKSQGRYKGIYVEEKLYRHARH
DESLNWTSRDHHESQECKGEDPGRHPNCGKNLGMKSTVEQHHAVHVLPQPFTCNNCGVAF
ADDTDPRVHHSTHLGEKSYKCDQYGKNLSQSQYLIVHCKTHSGETPYEFHEWPTGCKQSS
DLPRCQKVPSGDNPYKCKECGKGFRCNSSLHNHHRVHTGEMPYKCHVCGKAFGFRSLPCI
HQGVHTGKKPYKCEDCGKGFEQSSNLLIHQRVHTGEKPYKSSECGKCFSSSSVLQVHWRF
HTGEKPYRCGECGKGFSQSTHLHIHQRVHTGEKQYNAMCVERILGIVLFFTLIREFTLQK
NHINAKCVESALVTVHIFTSIKAITQERNHINVMSVVKASVGIQIFNVHLRVHRGQRPCK
CKACGKGFSRNSHLLAQQRVRIDKTQYTHCEHGKDLLTHQRLHEQRETL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttccaggaaagggtgacattcaaggacatagctgttatcttcaccaaggaa
gagctggcagtattggataaagcccagataaacctgtaccaagacgtgatgctggaaaac
ttcaggaacttcatctcagtggatgggattaaaaacaacattttgaatcttcagggaaag
gggttaatttacctttctcaagaagagcttcattgctggaagatttggaaacaaaggatc
cgggatttaagtgtgagtcaggattatatcatgaaccttcaagaacagtgttccccacat
ttagaagatgtatccctctgtgaagagtgggcaggcatgtctcttcagatttctgaaaat
gaaaactatgtagtaaatgccattatcaaaaatcaagatatcacagcatggcaaagcctg
acacaggttcttactccagaatcttggaggaaagccaacataatgaccgagccccagaaa
tctcagggaagatataagggaatttacgtggaagagaaattgtacagacatgctcggcat
gatgagagcctcaattggacctcacgtgatcatcatgagtcccaagaatgtaaaggagag
gaccctggtagacaccccaactgtgggaaaaacttgggtatgaaatcaacagttgaacaa
catcatgcggtccatgttttaccacagcctttcacatgtaataactgtggggtggccttt
gcagatgatacagatcctcgtgtccatcacagcactcatctaggagaaaaatcttataaa
tgtgaccagtatggaaagaacttaagtcagagccaatatcttattgttcattgtaaaacc
cactcaggagagactccctatgaattccatgaatggcctacaggctgcaaacagagctca
gaccttcccagatgtcagaaagtcccctcaggagacaatccctacaaatgtaaagaatgt
ggcaagggcttcaggtgcaactcctcccttcacaaccatcatcgagtccacacaggggag
atgccctacaaatgccacgtatgtgggaaagcgtttggatttaggtcacttccttgtatt
catcagggagtacacacagggaaaaagccctacaaatgtgaagattgtgggaagggcttt
gaacagagctccaaccttcttatccatcagagagtccacactggagagaagccctacaaa
tccagtgagtgtggcaagtgctttagttcaagctccgttcttcaagtccactggaggttt
cacacaggggagaaaccttataggtgtggtgagtgtggaaagggcttcagccaaagtaca
caccttcacattcaccagagagtccacacaggggagaaacaatacaatgcaatgtgtgtg
gaaaggattttgggtatagttctgttcttcacactcatcagagagttcacactgcagaaa
aaccatataaatgcgaagtgtgtggaaagtgctttagttacagttcatattttcacttcc
atcaaagcaatcacacaagagagaaaccatataaatgtgatgagtgtggtaaaggcttca
gttggaattcagatcttcaatgttcatctcagagtccacagaggacagaggccctgtaag
tgtaaggcatgtggtaagggcttcagtcgtaattcgcacctccttgcccaacagagagtg
cgtatagataagacacagtacacacattgtgagcatggcaaagaccttctgactcatcaa
agactacatgagcagagagaaacattataa

DBGET integrated database retrieval system