KEGG   Homo sapiens (human): 64699Help
Entry
64699             CDS       T01001                                 

Gene name
TMPRSS3, DFNB10, DFNB8, ECHOS1, TADG12
Definition
(RefSeq) transmembrane serine protease 3
  KO
K09634  transmembrane protease serine 3 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
H01705  Bilateral sudden sensorineural hearing loss
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    64699 (TMPRSS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     64699 (TMPRSS3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   64699 (TMPRSS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 64699
NCBI-ProteinID: NP_076927
OMIM: 605511
HGNC: 11877
Ensembl: ENSG00000160183
Vega: OTTHUMG00000086796
Pharos: P57727(Tbio)
UniProt: P57727
LinkDB All DBs
Position
21q22.3
AA seq 454 aa AA seqDB search
MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALI
LALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVF
TAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDK
VTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYH
LCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKR
LGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHA
AVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATS
FGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaatgatccgcctgctgttgaagcccccttctcattccgatcgctttttggc
cttgatgatttgaaaataagtcctgttgcaccagatgcagatgctgttgctgcacagatc
ctgtcactgctgccattgaagttttttccaatcatcgtcattgggatcattgcattgata
ttagcactggccattggtctgggcatccacttcgactgctcagggaagtacagatgtcgc
tcatcctttaagtgtatcgagctgatagctcgatgtgacggagtctcggattgcaaagac
ggggaggacgagtaccgctgtgtccgggtgggtggtcagaatgccgtgctccaggtgttc
acagctgcttcgtggaagaccatgtgctccgatgactggaagggtcactacgcaaatgtt
gcctgtgcccaactgggtttcccaagctatgtgagttcagataacctcagagtgagctcg
ctggaggggcagttccgggaggagtttgtgtccatcgatcacctcttgccagatgacaag
gtgactgcattacaccactcagtatatgtgagggagggatgtgcctctggccacgtggtt
accttgcagtgcacagcctgtggtcatagaaggggctacagctcacgcatcgtgggtgga
aacatgtccttgctctcgcagtggccctggcaggccagccttcagttccagggctaccac
ctgtgcgggggctctgtcatcacgcccctgtggatcatcactgctgcacactgtgtttat
gacttgtacctccccaagtcatggaccatccaggtgggtctagtttccctgttggacaat
ccagccccatcccacttggtggagaagattgtctaccacagcaagtacaagccaaagagg
ctgggcaatgacatcgcccttatgaagctggccgggccactcacgttcaatgaaatgatc
cagcctgtgtgcctgcccaactctgaagagaacttccccgatggaaaagtgtgctggacg
tcaggatggggggccacagaggatggagcaggtgacgcctcccctgtcctgaaccacgcg
gccgtccctttgatttccaacaagatctgcaaccacagggacgtgtacggtggcatcatc
tccccctccatgctctgcgcgggctacctgacgggtggcgtggacagctgccagggggac
agcggggggcccctggtgtgtcaagagaggaggctgtggaagttagtgggagcgaccagc
tttggcatcggctgcgcagaggtgaacaagcctggggtgtacacccgtgtcacctccttc
ctggactggatccacgagcagatggagagagacctaaaaacctga

DBGET integrated database retrieval system