KEGG   Homo sapiens (human): 6470Help
Entry
6470              CDS       T01001                                 

Gene name
SHMT1, CSHMT, SHMT
Definition
(RefSeq) serine hydroxymethyltransferase 1
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa01523  Antifolate resistance
Module
hsa_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    6470 (SHMT1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6470 (SHMT1)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    6470 (SHMT1)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    6470 (SHMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     6470 (SHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHMT Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 6470
NCBI-ProteinID: NP_004160
OMIM: 182144
HGNC: 10850
Ensembl: ENSG00000176974
Vega: OTTHUMG00000059094
Pharos: P34896(Tbio)
UniProt: P34896
LinkDB All DBs
Structure
PDB: 

Position
17p11.2
AA seq 483 aa AA seqDB search
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSG
SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY
INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGV
VPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGL
QGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLIL
VDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK
VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGL
PDF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgccagtcaacggggcccacaaggatgctgacctgtggtcctcacatgacaag
atgctggcacaacccctcaaagacagtgatgttgaggtttacaacatcattaagaaggag
agtaaccggcagagggttggattggagctgattgcctcggagaatttcgccagccgagca
gttttggaggccctaggctcttgcttaaataacaaatactctgaggggtacccgggccag
agatactatggcgggactgagtttattgatgaactggagaccctctgtcagaagcgagcc
ctgcaggcctataagctggacccacagtgctggggggtcaacgtccagccctactcaggc
tcccctgcaaactttgctgtgtacactgccctggtggaaccccatgggcgcatcatgggc
ctggaccttccggatgggggccacctgacccatgggttcatgacagacaagaagaaaatc
tctgccacgtccatcttctttgaatctatgccctacaaggtgaacccagatactggctac
atcaactatgaccagctggaggagaacgcacgcctcttccacccgaagctgatcatcgca
ggaaccagctgctactcccgaaacctggaatatgcccggctacggaagattgcagatgag
aacggggcgtatctcatggcggacatggctcacatcagcgggctggtggcggctggcgtg
gtgccctccccatttgaacactgccatgtggtgaccaccaccactcacaagaccctgcga
ggctgccgagctggcatgatcttctacaggaaaggagtgaaaagtgtggatcccaagact
ggcaaagagattctgtacaacctggagtctcttatcaattctgctgtgttccctggcctg
cagggaggtccccacaaccacgccattgctggggttgctgtggcactgaagcaagctatg
actctggaatttaaagtttatcaacaccaggtggtggccaactgcagggctctgtctgag
gccctgacggagctgggctacaaaatagtcacaggtggttctgacaaccatttgatcctt
gtggatctccgttccaaaggcacagatggtggaagggctgagaaggtgctagaagcctgt
tctattgcctgcaacaagaacacctgtccaggtgacagaagcgctctgcggcccagtgga
ctgcggctggggaccccagcactgacgtcccgtggacttttggaaaaagacttccaaaaa
gtagcccactttattcacagagggatagagctgaccctgcagatccagagcgacactggt
gtcagagccaccctgaaagagttcaaggagagactggcaggggataagtaccaggcggcc
gtgcaggctctccgggaggaggttgagagcttcgcctctctcttccctctgcctggcctg
cctgacttctaa

DBGET integrated database retrieval system