KEGG   Homo sapiens (human): 64764Help
Entry
64764             CDS       T01001                                 

Gene name
CREB3L2, BBF2H7
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TRH-TSH-TH signaling
nt06324  GHRH-GH-IGF signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64764 (CREB3L2)
   04024 cAMP signaling pathway
    64764 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    64764 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    64764 (CREB3L2)
   04152 AMPK signaling pathway
    64764 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    64764 (CREB3L2)
   04922 Glucagon signaling pathway
    64764 (CREB3L2)
   04915 Estrogen signaling pathway
    64764 (CREB3L2)
   04926 Relaxin signaling pathway
    64764 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    64764 (CREB3L2)
   04918 Thyroid hormone synthesis
    64764 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    64764 (CREB3L2)
   04916 Melanogenesis
    64764 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    64764 (CREB3L2)
   04927 Cortisol synthesis and secretion
    64764 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64764 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    64764 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    64764 (CREB3L2)
   04728 Dopaminergic synapse
    64764 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    64764 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    64764 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    64764 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    64764 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    64764 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    64764 (CREB3L2)
   05031 Amphetamine addiction
    64764 (CREB3L2)
   05034 Alcoholism
    64764 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    64764 (CREB3L2)
   04934 Cushing syndrome
    64764 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64764 (CREB3L2)
   05161 Hepatitis B
    64764 (CREB3L2)
   05163 Human cytomegalovirus infection
    64764 (CREB3L2)
   05165 Human papillomavirus infection
    64764 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    64764 (CREB3L2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    64764 (CREB3L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS-augmin3 JMY
Motif
Other DBs
NCBI-GeneID: 64764
NCBI-ProteinID: NP_919047
OMIM: 608834
HGNC: 23720
Ensembl: ENSG00000182158
Vega: OTTHUMG00000155744
Pharos: Q70SY1(Tbio)
UniProt: Q70SY1 Q68D60
LinkDB All DBs
Position
7q33
AA seq 520 aa AA seqDB search
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgatcctttcctctcagagaag
agtgtgtcaatggaggtggaaccttccccgacgtccccggcgcctctcatccaggctgag
cacagctactccctgtgcgaggagcctcgggcccagtcgcccttcacccacattaccacc
agtgacagcttcaatgacgatgaggtggaaagtgagaaatggtacctgtctacagacttc
ccttcaacatccatcaagacagagccagttacagacgaaccacccccaggactcgttccg
tctgtcactctgaccatcacagccatctccaccccgttggaaaaggaggaacctcctctg
gaaatgaacactggggttgattcctcgtgccagaccattattcctaaaattaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagccccagtggaccacctg
catttgccgcccacccctccgagcagtcacggcagtgactcagagggcagcctgagtccc
aacccacgcctgcaccccttcagcctgcctcagacccacagcccctccagagctgcaccc
cgggccccctccgccctctccagctcccctctcctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacagaggaggagaagaggaccctgatcgctgagggctatccc
atccccaccaaattgcccctgtcaaaatcagaggagaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgctcaggaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctagagaacactaataggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagctggcacgcagactggcacctgcctc
atggttgtggtgctgtgctttgccgttgcattcggcagcttctttcaaggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaggagccctacaca
gcctccgtggtgagatccagaaacctgctgatctacgaggaacattctcccccagaggag
tcatccagcccgggctcggctggggagctggggggctgggatagaggttcctccctgctc
agggtgtcagggctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgcttttggagctgcagcagcacctggtcagcgccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

DBGET integrated database retrieval system