KEGG   Homo sapiens (human): 64781Help
Entry
64781             CDS       T01001                                 

Gene name
CERK, LK4, dA59H18.2, dA59H18.3, hCERK
Definition
(RefSeq) ceramide kinase
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    64781 (CERK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     64781 (CERK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 64781
NCBI-ProteinID: NP_073603
OMIM: 610307
HGNC: 19256
Ensembl: ENSG00000100422
Vega: OTTHUMG00000150395
Pharos: Q8TCT0(Tbio)
UniProt: Q8TCT0 A0A024R4U8
LinkDB All DBs
Position
22q13.31
AA seq 537 aa AA seqDB search
MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAV
EETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLR
EMLEKLTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETL
YEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGS
TDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDS
EKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQ
LEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDL
ILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRF
GHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgacgggggcggcggagccgctgcaatccgtgctgtgggtgaagcagcagcgc
tgcgccgtgagcctggagcccgcgcgggctctgctgcgctggtggcggagcccggggccc
ggagccggcgcccccggcgcggatgcctgctctgtgcctgtatctgagatcatcgccgtt
gaggaaacagacgttcacgggaaacatcaaggcagtggaaaatggcagaaaatggaaaag
ccttacgcttttacagttcactgtgtaaagagagcacgacggcaccgctggaagtgggcg
caggtgactttctggtgtccagaggagcagctgtgtcacttgtggctgcagaccctgcgg
gagatgctggagaagctgacgtccagaccaaagcatttactggtatttatcaacccgttt
ggaggaaaaggacaaggcaagcggatatatgaaagaaaagtggcaccactgttcacctta
gcctccatcaccactgacatcatcgttactgaacatgctaatcaggccaaggagactctg
tatgagattaacatagacaaatacgacggcatcgtctgtgtcggcggagatggtatgttc
agcgaggtgctgcacggtctgattgggaggacgcagaggagcgccggggtcgaccagaac
cacccccgggctgtgctggtccccagtagcctccggattggaatcattcccgcagggtca
acggactgcgtgtgttactccaccgtgggcaccagcgacgcagaaacctcggcgctgcat
atcgttgttggggactcgctggccatggatgtgtcctcagtccaccacaacagcacactc
cttcgctactccgtgtccctgctgggctacggcttctacggggacatcatcaaggacagt
gagaagaaacggtggttgggtcttgccagatacgacttttcaggtttaaagaccttcctc
tcccaccactgctatgaagggacagtgtccttcctccctgcacaacacacggtgggatct
ccaagggataggaagccctgccgggcaggatgctttgtttgcaggcaaagcaagcagcag
ctggaggaggagcagaagaaagcactgtatggtttggaagctgcggaggacgtggaggag
tggcaagtcgtctgtgggaagtttctggccatcaatgccacaaacatgtcctgtgcttgt
cgccggagccccaggggcctctccccggctgcccacttgggagacgggtcttctgacctc
atcctcatccggaaatgctccaggttcaattttctgagatttctcatcaggcacaccaac
cagcaggaccagtttgacttcacttttgttgaagtttatcgcgtcaagaaattccagttt
acgtcgaagcacatggaggatgaggacagcgacctcaaggagggggggaagaagcgcttt
gggcacatttgcagcagccacccctcctgctgctgcaccgtctccaacagctcctggaac
tgcgacggggaggtcctgcacagccctgccatcgaggtcagagtccactgccagctggtt
cgactctttgcacgaggaattgaagagaatccgaagccagactcacacagctga

DBGET integrated database retrieval system