KEGG   Homo sapiens (human): 648Help
Entry
648               CDS       T01001                                 

Gene name
BMI1, FLVI2/BMI1, PCGF4, RNF51, flvi-2/bmi-1
Definition
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
Disease
H00025  Penile cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    648 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    648 (BMI1)
   05206 MicroRNAs in cancer
    648 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    648 (BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     648 (BMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-RING_10 zf-Nse
Motif
Other DBs
NCBI-GeneID: 648
NCBI-ProteinID: NP_005171
OMIM: 164831
HGNC: 1066
Ensembl: ENSG00000168283
Vega: OTTHUMG00000017807
Pharos: P35226(Tbio)
UniProt: P35226
LinkDB All DBs
Structure
PDB: 

Position
10p12.2
AA seq 326 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaagaccagaccactactgaatataaggtcagataaaactctccaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccttta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgacaaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

DBGET integrated database retrieval system