KEGG   Homo sapiens (human): 64919Help
Entry
64919             CDS       T01001                                 

Gene name
BCL11B, ATL1, ATL1-alpha, ATL1-beta, ATL1-delta, ATL1-gamma, CTIP-2, CTIP2, IDDFSTA, IMD49, RIT1, ZNF856B, hRIT1-alpha
Definition
(RefSeq) BAF chromatin remodeling complex subunit BCL11B
  KO
K22046  B-cell lymphoma/leukemia 11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00144  TLX1 rearrangement to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    64919 (BCL11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    64919 (BCL11B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    64919 (BCL11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 DUF3268 FYVE zf-C2H2_7
Motif
Other DBs
NCBI-GeneID: 64919
NCBI-ProteinID: NP_612808
OMIM: 606558
HGNC: 13222
Ensembl: ENSG00000127152
Vega: OTTHUMG00000028967
Pharos: Q9C0K0(Tbio)
UniProt: Q9C0K0 L8B7P7
LinkDB All DBs
Position
14q32.2
AA seq 894 aa AA seqDB search
MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQ
CQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVT
PDEDDHLLSPTKGICPKQENIAGPCRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPC
LPLPCCSARPVSGDGTQGEGQTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHA
QNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILR
DHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPA
MDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPP
QPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHK
AGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEE
EEELLLENESRPESSFSMDSELSRNRENGGGGVPGVPGAGGGAAKALADEKALVLGKVME
NVGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGAVNGRGGGFAP
GTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRH
FMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLG
GPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT
RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccgcaaacagggcaacccgcagcacttgtcccagagggagctcatcacccca
gaggctgaccatgtggaggccgccatcctcgaagaagacgagggtctggagatagaggag
ccaagtggcctggggctgatggtgggtggccccgaccctgacctgctcacctgtggccag
tgtcaaatgaacttccccttgggggacatcctggtttttatagagcacaaaaggaagcag
tgtggcggcagcttgggtgcctgctatgacaaggccctggacaaggacagcccgccaccc
tcctcacgctccgagctcaggaaagtgtccgagccggtggagatcgggatccaagtcacc
cccgacgaagatgaccacctgctctcacccacgaaaggcatctgtcccaagcaggagaac
attgcagggccgtgcaggcctgcccagctgccagcggtggcccccatagctgcctcctcc
caccctcactcatccgtgatcacttcacctctgcgtgccctgggcgctctcccgccctgc
ctccccctgccgtgctgcagcgcgcgcccggtctcgggtgacgggactcagggtgagggt
cagacggaggctccctttggatgccagtgtcagttgtcaggtaaagatgagccttccagc
tacatttgcacaacatgcaagcagcccttcaacagcgcgtggttcctgctgcagcacgcg
cagaacacgcacggcttccgcatctacctggagcccgggccggccagcagctcgctcacg
ccgcggctcaccatcccgccgccgctcgggccggaggccgtggcgcagtccccgctcatg
aatttcctgggcgacagcaaccccttcaacctgctgcgcatgacgggccccatcctgcgg
gaccacccgggcttcggcgagggccgcctgccgggcacgccgcctctcttcagtcccccg
ccgcgccaccacctggacccgcaccgcctcagtgccgaggagatggggctcgtcgcccag
caccccagtgccttcgaccgagtcatgcgcctgaaccccatggccatcgactcgcccgcc
atggacttctcgcggcggctccgcgagctggcgggcaacagctccacgccgccgcccgtg
tccccgggccgcggcaaccctatgcaccggctcctgaaccccttccagcccagccccaag
tccccgttcctgagcacgccgccgctgccgcccatgccccctggcggcacgccgcccccg
cagccgccagccaagagcaagtcgtgcgagttctgcggcaagaccttcaagttccagagc
aatctcatcgtgcaccggcgcagtcacacgggcgagaagccctacaagtgccagctgtgc
gaccacgcgtgctcgcaggccagcaagctcaagcgccacatgaagacgcacatgcacaag
gccggctcgctggccggccgctccgacgacgggctctcggccgccagctcccccgagccc
ggcaccagcgagctggcgggcgagggcctcaaggcggccgacggtgacttccgccaccac
gagagcgacccgtcgctgggccacgagccggaggaggaggacgaggaggaggaggaggag
gaggaggagctgctactggagaacgagagccggcccgagtcgagcttcagcatggactcg
gagctgagccgcaaccgcgagaacggcggtggtggggtgcccggggtcccgggcgcgggg
ggcggcgcggccaaggcgctggctgacgagaaggcgctggtgctgggcaaggtcatggag
aacgtgggcctaggcgcactgccgcagtacggcgagctcctggccgacaagcagaagcgc
ggcgccttcctgaagcgtgcggcgggcggcggggacgcgggcgacgacgacgacgcgggc
ggctgcggggacgcgggcgcgggcggcgcggtcaacgggcgcgggggcggcttcgcgcca
ggcaccgagcccttccccgggctcttcccgcgcaagcccgcgccgctgcccagccccggg
ctcaacagcgccgccaagcgcatcaaggtggagaaggacctggagctgccgcccgccgcg
ctcatcccgtccgagaacgtgtactcgcagtggctggtgggctacgcggcgtcgcggcac
ttcatgaaggaccccttcctgggcttcacggacgcacgacagtcgcccttcgccacgtcg
tccgagcactcgtccgagaacggcagcctgcgcttctccacgccgcccggggacctgctg
gacggcggcctctcgggccgcagcggcacggccagcggaggcagcaccccgcacctgggc
ggcccgggccccgggcggcccagctccaaggagggccgccgcagcgacacgtgcgagtac
tgcggcaaggtgttcaagaactgcagcaacttgacggtgcaccggcggagccacaccggc
gagcggccttacaagtgcgagctgtgcaactacgcgtgcgcgcagagcagcaagctcacg
cgccacatgaagacgcacgggcagatcggcaaggaggtgtaccgctgcgacatctgccag
atgcccttcagcgtctacagcaccctggagaaacacatgaaaaagtggcacggcgagcac
ttgctgactaacgacgtcaaaatcgagcaggccgagaggagctaa

DBGET integrated database retrieval system