KEGG   Homo sapiens (human): 6494Help
Entry
6494              CDS       T01001                                 

Gene name
SIPA1, SPA1
Definition
(RefSeq) signal-induced proliferation-associated 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6494 (SIPA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    6494 (SIPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rap_GAP PDZ PDZ_6 MscS_porin ATG16 CENP-F_N PI3K_P85_iSH2 ZapB Rab5-bind APG6_N DUF4472 HAUS-augmin3 YabA LPP Lzipper-MIP1 TMF_TATA_bd
Motif
Other DBs
NCBI-GeneID: 6494
NCBI-ProteinID: NP_006738
OMIM: 602180
HGNC: 10885
Ensembl: ENSG00000213445
Vega: OTTHUMG00000166541
Pharos: Q96FS4(Tbio)
UniProt: Q96FS4
LinkDB All DBs
Position
11q13.1
AA seq 1042 aa AA seqDB search
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgtgggccggcggtgtggggagccctcggcggggcatggcccctgcgtccaca
gatgacctctttgcccgcaagctgcgccagccagcaaggcccccgctgacaccgcacacc
ttcgagccgaggccagtccggggcccactcctgcgcagcggcagcgatgcaggcgaggcc
aggccccccacgccagccagcccccgtgcccgtgcccacagccacgaagaggccagccga
cctgcagccacttccacccggctcttcactgacccgctggcactgctggggctgccagca
gaggaaccagagcctgccttcccaccagtgcttgagcctcgatggtttgcccactatgac
gtgcaaagcctgctctttgattgggctccgaggtctcaggggatggggagccactcagag
gccagctctgggaccctggcttcagccgaggaccaggctgccagctcggacctgctgcat
ggggcacctggctttgtgtgtgagctcgggggtgagggtgagctaggcctgggtggacca
gcatccccacctgtgccccctgcactgcccaacgcggccgtgtccatcctggaggagcca
cagaaccgaacctcggcctacagcctggagcacgcagacctgggtgctggctactaccgc
aaatacttctatggcaaagaacatcagaacttcttcgggatggacgagtcgctgggcccg
gtggcagtgagcctgcggcgggaggagaaggagggcagcggagggggcaccctgcacagc
taccgcgtcatcgtgcggaccacgcagctccggacactccgtggcaccatctcggaggac
gcgctgccgccggggcccccacggggtctgtccccaaggaaacttctggagcacgtggcg
ccgcagctgagccccagctgcctgcgcctgggctcagcttcacccaaggtaccacggacg
ctgctcacactggatgagcaagtgctgagcttccaacgcaaggtgggcatcctgtactgc
cgggcgggccagggctcggaggaggagatgtacaacaaccaggaggcgggaccggccttc
atgcagtttctcaccttgctgggcgatgtggtgcggctcaaaggctttgagagttaccgg
gcccagctagacaccaaaacggattccacaggcacgcactccctctacaccacataccag
gaccacgagatcatgttccacgtgtccacgatgctgccttacacccctaataaccagcag
cagctcctccggaagcgccacattggcaacgacattgtgaccatcgtgttccaggagcct
ggcagcaagcccttctgccccaccaccatccgctcgcacttccagcacgtgttcctagtg
gtgcgggcacacacaccctgcacgccacacaccacctacagggtggccgtgagccgcacc
caggacacccctgccttcgggccagctctgcctgctggcggaggccccttcgcagccaac
gccgacttccgggccttcctgctggccaaagcgctgaatggtgagcaggcggccggccac
gcgcgccagttccacgccatggccacgcgcacccgccagcagtacctgcaagacctggcc
accaacgaggtgaccactacgtcgctggactcggcttcacgcttcggcctgccctccctg
ggtgggaggcgccgggcggcccctcggggcccaggcgccgagctgcaggcagcgggctca
ctggtgtggggagtgcgcgcggcgcccggggcgcgggtcgccgccggggctcaggcgagc
ggccccgaaggcatcgaggtgccctgcctgctgggcatctcggccgaggctctggtgctg
gtggcgccgcgcgacggccgcgtagtgttcaattgcgcctgtcgcgacgtgctggcctgg
accttctccgagcagcagctggacctgtaccacggccgcggggaggcgatcacgctgcgc
ttcgacgggtcccccggccaagccgtgggcgaggtggtggcgcgcctgcagctggtgagc
cgtggctgcgagacccgcgagctggcgctgccccgcgacggtcaaggccgcctgggcttc
gaggtggacgccgagggattcgtcacgcacgtggagcgcttcacattcgccgagacggcg
gggctgcggcccggggcgcgcctcctgcgcgtgtgcggccagactctgcccagcctccgg
cccgaggccgctgcccagctcctgcgctcggcgcccaaggtctgcgtcaccgtcctgccc
cccgacgagagcggccggccccgcaggagtttttcggagctgtacacgctgtcgctgcag
gagcctagccggcggggggccccagatcctgtgcaggatgaggtccagggggtgaccctg
ctgcccaccacaaagcagctgctgcacctgtgcctgcaagatggtggcagtcctccaggg
cctggggatctggccgaggagaggactgagttcctgcacagccagaactcgctgtcacca
cgcagctctctgtcggatgaggccccagtcctgcccaacaccaccccggacctcctcctg
gccaccacagccaagccatcagtacccagtgctgacagtgagacacccctgacccaggac
aggccaggcagtcccagtggctctgaggacaagggcaacccggcgccggagctgagggcc
tcctttctgccacgtaccttgtctctgcggaactccatcagcaggatcatgtcggaggcg
ggcagtgggaccctggaggacgagtggcaggccatctcggagattgcctctacttgcaac
accattctggagtcgctgtcccgagagggacagcccatcccagagagtggagaccctaag
ggaactccaaaatctgatgctgagccagagcctgggaacctctcagagaaggtctctcac
ttggagtccatgctcaggaagctgcaggaggacctgcagaaggagaaggcggacagggcg
gccctggaggaggaggtgcggagcctgagacacaacaaccggcggctgcaggcggagtct
gagagtgcagccacacgcctcctcctggcctccaagcagctgggctcacccaccgccgac
ctggcctga

DBGET integrated database retrieval system