KEGG   Homo sapiens (human): 6495Help
Entry
6495              CDS       T01001                                 

Gene name
SIX1, BOS3, DFNA23, TIP39
Definition
(RefSeq) SIX homeobox 1
  KO
K15614  homeobox protein SIX1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00120  MLL-ENL fusion to transcriptional activation
Disease
H00453  Branchio-oto-renal syndrome
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    6495 (SIX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, SIM
    6495 (SIX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIX1_SD Homeobox Homeobox_KN Homez HTH_3 YdaS_antitoxin Phage_mat-A KilA-N
Motif
Other DBs
NCBI-GeneID: 6495
NCBI-ProteinID: NP_005973
OMIM: 601205
HGNC: 10887
Ensembl: ENSG00000126778
Vega: OTTHUMG00000140334
Pharos: Q15475(Tbio)
UniProt: Q15475
LinkDB All DBs
Position
14q23.1
AA seq 284 aa AA seqDB search
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgctgccgtcgtttggctttacgcaggagcaagtggcgtgcgtgtgcgaggtt
ctgcagcaaggcggaaacctggagcgcctgggcaggttcctgtggtcactgcccgcctgc
gaccacctgcacaagaacgagagcgtactcaaggccaaggcggtggtcgccttccaccgc
ggcaacttccgtgagctctacaagatcctggagagccaccagttctcgcctcacaaccac
cccaaactgcagcaactgtggctgaaggcgcattacgtggaggccgagaagctgcgcggc
cgacccctgggcgccgtgggcaaatatcgggtgcgccgaaaatttccactgccgcgcacc
atctgggacggcgaggagaccagctactgcttcaaggagaagtcgaggggtgtcctgcgg
gagtggtacgcgcacaatccctacccatcgccgcgtgagaagcgggagctggccgaggcc
accggcctcaccaccacccaggtcagcaactggtttaagaaccggaggcaaagagaccgg
gccgcggaggccaaggaaagggagaacaccgaaaacaataactcctcctccaacaagcag
aaccaactctctcctctggaagggggcaagccgctcatgtccagctcagaagaggaattc
tcacctccccaaagtccagaccagaactcggtccttctgctgcagggcaatatgggccac
gccaggagctcaaactattctctcccgggcttaacagcctcgcagcccagtcacggcctg
cagacccaccagcatcagctccaagactctctgctcggccccctcacctccagtctggtg
gacttggggtcctaa

DBGET integrated database retrieval system