KEGG   Homo sapiens (human): 6500Help
Entry
6500              CDS       T01001                                 

Gene name
SKP1, EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Definition
(RefSeq) S-phase kinase associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6500 (SKP1)
   04120 Ubiquitin mediated proteolysis
    6500 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6500 (SKP1)
   04350 TGF-beta signaling pathway
    6500 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    6500 (SKP1)
   04114 Oocyte meiosis
    6500 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    6500 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6500 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6500 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6500 (SKP1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6500 (SKP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     6500 (SKP1)
   Cul7 complex
     6500 (SKP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     6500 (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     6500 (SKP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ Skp1
Motif
Other DBs
NCBI-GeneID: 6500
NCBI-ProteinID: NP_733779
OMIM: 601434
HGNC: 10899
Ensembl: ENSG00000113558
Vega: OTTHUMG00000129117
Pharos: P63208(Tbio)
UniProt: P63208
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 163 aa AA seqDB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgtggaaatt
gccaaacaatctgtgactattaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgtgaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaagatgatgagaacaaagaaaag
cgaacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaactcattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
atcaaaaatgactttactgaagaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

KEGG   Homo sapiens (human): 8454Help
Entry
8454              CDS       T01001                                 

Gene name
CUL1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8454 (CUL1)
   04120 Ubiquitin mediated proteolysis
    8454 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8454 (CUL1)
   04340 Hedgehog signaling pathway
    8454 (CUL1)
   04350 TGF-beta signaling pathway
    8454 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8454 (CUL1)
   04114 Oocyte meiosis
    8454 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8454 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8454 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8454 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8454 (CUL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     8454 (CUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 8454
NCBI-ProteinID: NP_003583
OMIM: 603134
HGNC: 2551
Ensembl: ENSG00000055130
Vega: OTTHUMG00000152776
Pharos: Q13616(Tbio)
UniProt: Q13616 A0A090N7U0 B3KTW0
LinkDB All DBs
Structure
PDB: 

Position
7q36.1
AA seq 776 aa AA seqDB search
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacccggagccagaacccccacggcctgaagcagattggcctggaccagatc
tgggacgacctcagagccggcatccagcaggtgtacacacggcagagcatggccaagtcc
agatatatggagctctacactcatgtttataactactgtactagtgttcaccagtcaaac
caagcacgaggagctggagttcctccttctaagtcgaaaaaggggcagacacctggagga
gctcagtttgttggcctggaattatataaacgacttaaggaatttttgaagaattacttg
acaaatcttcttaaggatggagaagatttgatggatgagagtgtactgaaattctacact
caacaatgggaagattatcgattttcaagcaaagtgctgaatggaatttgtgcctacctc
aatagacattgggttcgccgtgaatgtgacgaaggacgaaaaggaatatatgaaatctat
tcgcttgcattggtgacttggagagactgtctgttcaggccactgaataaacaggtaaca
aatgctgttttaaagctgattgaaaaggaaaggaatggtgaaaccatcaatacaagattg
attagtggagttgtacagtcttacgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccagttactgaatat
atgaaaaaggcagaggctcgtctgcttgaggaacaacgaagagttcaggtttaccttcat
gaaagcacacaagatgaattagcaaggaaatgtgaacaagtcctcattgaaaaacacttg
gaaattttccacacagaatttcagaatttattggatgctgacaaaaatgaagatttggga
cgcatgtataatcttgtatctagaatccaggatggcctaggagaattgaaaaaactgttg
gagacacacattcataatcagggtcttgcagccattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtatgtacagacagtgcttgatgttcataaaaaatacaatgccctg
gtaatgtctgcattcaacaatgacgctggctttgtggctgctcttgataaggcttgtggt
cgcttcataaacaacaacgcggttaccaagatggcccaatcatccagtaaatcccctgag
ttgctggctcgatactgtgactccttgttgaagaaaagttccaagaacccagaggaggca
gaactagaagacacactcaatcaagtgatggttgtcttcaagtacatagaagacaaagac
gtatttcagaagttctatgcgaagatgctcgccaagaggctcgtccaccagaacagtgca
agtgacgatgccgaagccagcatgatctccaagttaaagcaagcttgcgggttcgagtac
acctctaaacttcagcgcatgtttcaagacattggcgtgagcaaagatctgaacgagcaa
ttcaaaaagcacttgacaaactcagaacccctagacttggatttcagcattcaagtgctg
agctccgggtcctggcccttccagcagtcttgtacatttgccttgccgtcagagttggaa
cgtagttatcagcgattcacagctttctacgccagccgccacagtggccgaaaattgacg
tggttatatcagttgtctaaaggagaattggtaactaactgcttcaaaaacagatatact
ttgcaggcgtcgacattccagatggctatcctgcttcagtacaacacggaagatgcctac
actgtgcagcagctgaccgacagcactcaaattaaaatggacattttggcgcaagtttta
cagattttattaaagtcgaagctattggtcttggaagatgaaaatgcaaatgttgatgag
gtggaattgaagccagataccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaaccgaacagaagcaggaacaagaaaccacacac
aaaaacatcgaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaag
atgaggaaggttctgaaacaccagcagttacttggcgaggtcctcactcagctgtcctcc
aggttcaaacctcgagtccctgtgatcaagaaatgcattgacattctaattgagaaagaa
tatttggagcgagtggatggtgaaaaggacacctacagttacttggcttaa

KEGG   Homo sapiens (human): 9978Help
Entry
9978              CDS       T01001                                 

Gene name
RBX1, BA554C12.1, RNF75, ROC1
Definition
(RefSeq) ring-box 1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04066  HIF-1 signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06225  HIF-1 signaling
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06264  Renal cell carcinoma
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9978 (RBX1)
   04120 Ubiquitin mediated proteolysis
    9978 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    9978 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    9978 (RBX1)
   04350 TGF-beta signaling pathway
    9978 (RBX1)
   04066 HIF-1 signaling pathway
    9978 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9978 (RBX1)
   04114 Oocyte meiosis
    9978 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    9978 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9978 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    9978 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9978 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9978 (RBX1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9978 (RBX1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     9978 (RBX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   9978 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     9978 (RBX1)
   ECV complex
     9978 (RBX1)
   Cul3 complex
     9978 (RBX1)
   Cul4 complex
     9978 (RBX1)
   Cul7 complex
     9978 (RBX1)
   Cul9 complex
     9978 (RBX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      9978 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      9978 (RBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 9978
NCBI-ProteinID: NP_055063
OMIM: 603814
HGNC: 9928
Ensembl: ENSG00000100387
Vega: OTTHUMG00000151298
Pharos: P62877(Tbio)
UniProt: P62877
LinkDB All DBs
Structure
PDB: 

Position
22q13.2
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system