KEGG   Homo sapiens (human): 6506
Entry
6506              CDS       T01001                                 

Gene name
SLC1A2, EAAT2, EIEE41, GLT-1, HBGT
Definition
(RefSeq) solute carrier family 1 member 2
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6506 (SLC1A2)
   04721 Synaptic vesicle cycle
    6506 (SLC1A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6506 (SLC1A2)
   05016 Huntington disease
    6506 (SLC1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6506 (SLC1A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6506 (SLC1A2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 6506
NCBI-ProteinID: NP_004162
OMIM: 600300
HGNC: 10940
Ensembl: ENSG00000110436
Vega: OTTHUMG00000044391
Pharos: P43004(Tchem)
UniProt: P43004
LinkDB
Position
11p13
AA seq 574 aa
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcatctacggaaggtgccaacaatatgcccaagcaggtggaagtgcgaatgcacgac
agtcatcttggctcagaggaacccaagcaccggcacctgggcctgcgcctgtgtgacaag
ctggggaagaatctgctgctcaccctgacggtgtttggtgtcatcctgggagcagtgtgt
ggagggcttcttcgcttggcatctcccatccaccctgatgtggttatgttaatagccttc
ccaggggatatactcatgaggatgctaaaaatgctcattctccctctaatcatctccagc
ttaatcacagggttgtcaggcctggatgctaaggctagtggccgcttgggcacgagagcc
atggtgtattacatgtccacgaccatcattgctgcagtactgggggtcattctggtcttg
gctatccatccaggcaatcccaagctcaagaagcagctggggcctgggaagaagaatgat
gaagtgtccagcctggatgccttcctggaccttattcgaaatctcttccctgaaaacctt
gtccaagcctgctttcaacagattcaaacagtgacgaagaaagtcctggttgcaccaccg
ccggacgaggaggccaacgcaaccagcgctgttgtctctctgttgaacgagactgtgact
gaggtgccggaggagactaagatggttatcaagaagggcctggagttcaaggatgggatg
aacgtcttaggtctgatagggtttttcattgcttttggcatcgctatggggaagatggga
gatcaggccaagctgatggtggatttcttcaacattttgaatgagattgtaatgaagtta
gtgatcatgatcatgtggtactctcccctgggtatcgcctgcctgatctgtggaaagatc
attgcaatcaaggacttagaagtggttgctaggcaactggggatgtacatggtaacagtg
atcataggcctcatcatccacgggggcatctttctccccttgatttactttgtagtgacc
aggaaaaaccccttctccttttttgctggcattttccaagcttggatcactgccctgggc
accgcttccagtgctggaactttgcctgtcacctttcgttgcctggaagaaaatctgggg
attgataagcgtgtgactagattcgtccttcctgttggagcaaccattaacatggatggt
acagccctttatgaagcggtagccgccatctttatagcccaaatgaatggtgttgtcctg
gatggaggacagattgtgactgtaagcctcacagccaccctggcaagcgtcggcgcggcc
agtatccccagtgccgggctggtcaccatgctcctcattctgacagccgtgggcctgcca
acagaggacatcagcctgctggtggctgtggactggctgctggacaggatgagaacttca
gtcaatgttgtgggtgactcttttggggctgggatagtctatcacctctccaagtctgag
ctggataccattgactcccagcatcgagtgcatgaagatattgaaatgaccaagactcaa
tccatttatgatgacatgaagaaccacagggaaagcaactctaatcaatgtgtctatgct
gcacacaactctgtcatagtagatgaatgcaaggtaactctggcagccaatggaaagtca
gccgactgcagtgttgaggaagaaccttggaaacgtgagaaataa

KEGG   Homo sapiens (human): 6507
Entry
6507              CDS       T01001                                 

Gene name
SLC1A3, EA6, EAAT1, GLAST, GLAST1
Definition
(RefSeq) solute carrier family 1 member 3
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
hsa05016  Huntington disease
Disease
H00749  Episodic ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6507 (SLC1A3)
   04721 Synaptic vesicle cycle
    6507 (SLC1A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    6507 (SLC1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6507 (SLC1A3)
   04147 Exosome [BR:hsa04147]
    6507 (SLC1A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6507 (SLC1A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   6507 (SLC1A3)
SSDB
Motif
Pfam: SDF MT
Other DBs
NCBI-GeneID: 6507
NCBI-ProteinID: NP_004163
OMIM: 600111
HGNC: 10941
Ensembl: ENSG00000079215
Vega: OTTHUMG00000090793
Pharos: P43003(Tchem)
UniProt: P43003 Q8N169 A0A024R050
LinkDB
Position
5p13.2
AA seq 542 aa
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgactaaaagcaatggagaagagcccaagatggggggcaggatggagagattccagcag
ggagtccgtaaacgcacacttttggccaagaagaaagtgcagaacattacaaaggaggat
gttaaaagttacctgtttcggaatgcttttgtgctgctcacagtcaccgctgtcattgtg
ggtacaatccttggatttaccctccgaccatacagaatgagctaccgggaagtcaagtac
ttctcctttcctggggaacttctgatgaggatgttacagatgctggtcttaccacttatc
atctccagtcttgtcacaggaatggcggcgctagatagtaaggcatcagggaagatggga
atgcgagctgtagtctattatatgactaccaccatcattgctgtggtgattggcataatc
attgtcatcatcatccatcctgggaagggcacaaaggaaaacatgcacagagaaggcaaa
attgtacgagtgacagctgcagatgccttcctggacttgatcaggaacatgttccctcca
aatctggtagaagcctgctttaaacagtttaaaaccaactatgagaagagaagctttaaa
gtgcccatccaggccaacgaaacgcttgtgggtgctgtgataaacaatgtgtctgaggcc
atggagactcttacccgaatcacagaggagctggtcccagttccaggatctgtgaatgga
gtcaatgccctgggtctagttgtcttctccatgtgcttcggttttgtgattggaaacatg
aaggaacaggggcaggccctgagagagttctttgattctcttaacgaagccatcatgaga
ctggtagcagtaataatgtggtatgcccccgtgggtattctcttcctgattgctgggaag
attgtggagatggaagacatgggtgtgattggggggcagcttgccatgtacaccgtgact
gtcattgttggcttactcattcacgcagtcatcgtcttgccactcctctacttcttggta
acacggaaaaacccttgggtttttattggagggttgctgcaagcactcatcaccgctctg
gggacctcttcaagttctgccaccctacccatcaccttcaagtgcctggaagagaacaat
ggcgtggacaagcgcgtcaccagattcgtgctccccgtaggagccaccattaacatggat
gggactgccctctatgaggctttggctgccattttcattgctcaagttaacaactttgaa
ctgaacttcggacaaattattacaatcagcatcacagccacagctgccagtattggggca
gctggaattcctcaggcgggcctggtcactatggtcattgtgctgacatctgtcggcctg
cccactgacgacatcacgctcatcatcgcggtggactggttcctggatcgcctccggacc
accaccaacgtactgggagactccctgggagctgggattgtggagcacttgtcacgacat
gaactgaagaacagagatgttgaaatgggtaactcagtgattgaagagaatgaaatgaag
aaaccatatcaactgattgcacaggacaatgaaactgagaaacccatcgacagtgaaacc
aagatgtag

DBGET integrated database retrieval system