KEGG   Homo sapiens (human): 6510Help
Entry
6510              CDS       T01001                                 

Gene name
SLC1A5, AAAT, ASCT2, ATBO, M7V1, M7VS1, R16, RDRC
Definition
(RefSeq) solute carrier family 1 member 5
  KO
K05616  solute carrier family 1 (neutral amino acid transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
hsa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    6510 (SLC1A5)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    6510 (SLC1A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6510 (SLC1A5)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6510 (SLC1A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 6510
NCBI-ProteinID: NP_005619
OMIM: 109190
HGNC: 10943
Ensembl: ENSG00000105281
Vega: OTTHUMG00000183434
Pharos: Q15758(Tbio)
UniProt: Q15758 Q59ES3
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 541 aa AA seqDB search
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVV
AVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLD
PGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEV
LDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIV
FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFA
RLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLM
MKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAG
LLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESV
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgatcctcctcgagactccaaggggctcgcagcggcggagcccaccgccaac
gggggcctggcgctggcctccatcgaggaccaaggcgcggcagcaggcggctactgcggt
tcccgggaccaggtgcgccgctgccttcgagccaacctgcttgtgctgctgacagtggtg
gccgtggtggccggcgtggcgctgggactgggggtgtcgggggccgggggtgcgctggcg
ttgggcccggagcgcttgagcgccttcgtcttcccgggcgagctgctgctgcgtctgctg
cggatgatcatcttgccgctggtggtgtgcagcttgatcggcggcgccgccagcctggac
cccggcgcgctcggccgtctgggcgcctgggcgctgctctttttcctggtcaccacgctg
ctggcgtcggcgctcggagtgggcttggcgctggctctgcagccgggcgccgcctccgcc
gccatcaacgcctccgtgggagccgcgggcagtgccgaaaatgcccccagcaaggaggtg
ctcgattcgttcctggatcttgcgagaaatatcttcccttccaacctggtgtcagcagcc
tttcgctcatactctaccacctatgaagagaggaatatcaccggaaccagggtgaaggtg
cccgtggggcaggaggtggaggggatgaacatcctgggcttggtagtgtttgccatcgtc
tttggtgtggcgctgcggaagctggggcctgaaggggagctgcttatccgcttcttcaac
tccttcaatgaggccaccatggttctggtctcctggatcatgtggtacgcccctgtgggc
atcatgttcctggtggctggcaagatcgtggagatggaggatgtgggtttactctttgcc
cgccttggcaagtacattctgtgctgcctgctgggtcacgccatccatgggctcctggta
ctgcccctcatctacttcctcttcacccgcaaaaacccctaccgcttcctgtggggcatc
gtgacgccgctggccactgcctttgggacctcttccagttccgccacgctgccgctgatg
atgaagtgcgtggaggagaataatggcgtggccaagcacatcagccgtttcatcctgccc
atcggcgccaccgtcaacatggacggtgccgcgctcttccagtgcgtggccgcagtgttc
attgcacagctcagccagcagtccttggacttcgtaaagatcatcaccatcctggtcacg
gccacagcgtccagcgtgggggcagcgggcatccctgctggaggtgtcctcactctggcc
atcatcctcgaagcagtcaacctcccggtcgaccatatctccttgatcctggctgtggac
tggctagtcgaccggtcctgtaccgtcctcaatgtagaaggtgacgctctgggggcagga
ctcctccaaaattacgtggaccgtacggagtcgagaagcacagagcctgagttgatacaa
gtgaagagtgagctgcccctggatccgctgccagtccccactgaggaaggaaaccccctc
ctcaaacactatcgggggcccgcaggggatgccacggtcgcctctgagaaggaatcagtc
atgtaa

DBGET integrated database retrieval system