KEGG   Homo sapiens (human): 6513Help
Entry
6513              CDS       T01001                                 

Gene name
SLC2A1, CSE, DYT17, DYT18, DYT9, EIG12, GLUT, GLUT-1, GLUT1, GLUT1DS, HTLVR, PED, SDCHCN
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04911  Insulin secretion
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04976  Bile secretion
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
hsa05230  Central carbon metabolism in cancer
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00232  Hereditary stomatocytosis
H00808  Idiopathic generalized epilepsies
H00831  Primary dystonia
H00836  GLUT1 deficiency syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6513 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6513 (SLC2A1)
   04922 Glucagon signaling pathway
    6513 (SLC2A1)
   04920 Adipocytokine signaling pathway
    6513 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    6513 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    6513 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6513 (SLC2A1)
   05230 Central carbon metabolism in cancer
    6513 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    6513 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    6513 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6513 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6513 (SLC2A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   6513 (SLC2A1)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6513 (SLC2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Motif
Other DBs
NCBI-GeneID: 6513
NCBI-ProteinID: NP_006507
OMIM: 138140
HGNC: 11005
Ensembl: ENSG00000117394
Vega: OTTHUMG00000007657
Pharos: P11166(Tchem)
UniProt: P11166 Q59GX2
LinkDB All DBs
Structure
PDB: 

Position
1p34.2
AA seq 492 aa AA seqDB search
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatgggtccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttttctgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtccgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaacaaggacctgtggcccctgctgctgagcatcatcttcatcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagtccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctaaagaagctgcgcgggacagctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccccgcctaccgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtctggcatcaacgctgtcttctattactccacgagcatcttcgagaag
gcgggggtgcagcagcctgtgtatgccaccattggctccggtatcgtcaacacggccttc
actgtcgtgtcgctgtttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctcgctggcatggcgggttgtgccatactcatgaccatcgcgctagcactgctggagcag
ctaccctggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtgggtcctggccccatcccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgccgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

KEGG   Homo sapiens (human): 6514Help
Entry
6514              CDS       T01001                                 

Gene name
SLC2A2, GLUT2
Definition
(RefSeq) solute carrier family 2 member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04917  Prolactin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04950  Maturity onset diabetes of the young
hsa04973  Carbohydrate digestion and absorption
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00818  Transport of glucose
N00819  Mutation-inactivated SLC2A2 to transport of glucose
Disease
H00069  Glycogen storage disease
H01947  Fanconi-Bickel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6514 (SLC2A2)
   04922 Glucagon signaling pathway
    6514 (SLC2A2)
   04917 Prolactin signaling pathway
    6514 (SLC2A2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    6514 (SLC2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    6514 (SLC2A2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    6514 (SLC2A2)
   04950 Maturity onset diabetes of the young
    6514 (SLC2A2)
   04931 Insulin resistance
    6514 (SLC2A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6514 (SLC2A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   6514 (SLC2A2)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6514 (SLC2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 OATP ParB HlyE
Motif
Other DBs
NCBI-GeneID: 6514
NCBI-ProteinID: NP_000331
OMIM: 138160
HGNC: 11006
Ensembl: ENSG00000163581
Vega: OTTHUMG00000158997
Pharos: P11168(Tbio)
UniProt: P11168
LinkDB All DBs
Position
3q26.2
AA seq 524 aa AA seqDB search
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagataaggtcactgggaccctggttttcactgtcatcactgctgtgctgggt
tccttccagtttggatatgacattggtgtgatcaatgcacctcaacaggtaataatatct
cactatagacatgttttgggtgttccactggatgaccgaaaagctatcaacaactatgtt
atcaacagtacagatgaactgcccacaatctcatactcaatgaacccaaaaccaacccct
tgggctgaggaagagactgtggcagctgctcaactaatcaccatgctctggtccctgtct
gtatccagctttgcagttggtggaatgactgcatcattctttggtgggtggcttggggac
acacttggaagaatcaaagccatgttagtagcaaacattctgtcattagttggagctctc
ttgatggggttttcaaaattgggaccatctcatatacttataattgctggaagaagcata
tcaggactatattgtgggctaatttcaggcctggttcctatgtatatcggtgaaattgct
ccaaccgctctcaggggagcacttggcacttttcatcagctggccatcgtcacgggcatt
cttattagtcagattattggtcttgaatttatcttgggcaattatgatctgtggcacatc
ctgcttggcctgtctggtgtgcgagccatccttcagtctctgctactctttttctgtcca
gaaagccccagatacctttacatcaagttagatgaggaagtcaaagcaaaacaaagcttg
aaaagactcagaggatatgatgatgtcaccaaagatattaatgaaatgagaaaagaaaga
gaagaagcatcgagtgagcagaaagtctctataattcagctcttcaccaattccagctac
cgacagcctattctagtggcactgatgctgcatgtggctcagcaattttccggaatcaat
ggcattttttactactcaaccagcatttttcagacggctggtatcagcaaacctgtttat
gcaaccattggagttggcgctgtaaacatggttttcactgctgtctctgtattccttgtg
gagaaggcagggcgacgttctctctttctaattggaatgagtgggatgtttgtttgtgcc
atcttcatgtcagtgggacttgtgctgctgaataagttctcttggatgagttatgtgagc
atgatagccatcttcctctttgtcagcttctttgaaattgggccaggcccgatcccctgg
ttcatggtggctgagtttttcagtcaaggaccacgtcctgctgctttagcaatagctgca
ttcagcaattggacctgcaatttcattgtagctctgtgtttccagtacattgcggacttc
tgtggaccttatgtgtttttcctctttgctggagtgctcctggcctttaccctgttcaca
ttttttaaagttccagaaaccaaaggaaagtcttttgaggaaattgctgcagaattccaa
aagaagagtggctcagcccacaggccaaaagctgctgtagaaatgaaattcctaggagct
acagagactgtgtaa

DBGET integrated database retrieval system