KEGG   Homo sapiens (human): 6513Help
Entry
6513              CDS       T01001                                 

Gene name
SLC2A1, CSE, DYT17, DYT18, DYT9, EIG12, GLUT, GLUT-1, GLUT1, GLUT1DS, HTLVR, PED, SDCHCN
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04911  Insulin secretion
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04976  Bile secretion
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
hsa05230  Central carbon metabolism in cancer
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00232  Hereditary stomatocytosis
H00808  Idiopathic generalized epilepsies
H00831  Primary dystonia
H00836  GLUT1 deficiency syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6513 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6513 (SLC2A1)
   04922 Glucagon signaling pathway
    6513 (SLC2A1)
   04920 Adipocytokine signaling pathway
    6513 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    6513 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    6513 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6513 (SLC2A1)
   05230 Central carbon metabolism in cancer
    6513 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    6513 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    6513 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6513 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6513 (SLC2A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   6513 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6513 (SLC2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Motif
Other DBs
NCBI-GeneID: 6513
NCBI-ProteinID: NP_006507
OMIM: 138140
HGNC: 11005
Ensembl: ENSG00000117394
Vega: OTTHUMG00000007657
Pharos: P11166(Tchem)
UniProt: P11166 Q59GX2
LinkDB All DBs
Structure
PDB: 

Position
1p34.2
AA seq 492 aa AA seqDB search
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatgggtccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttttctgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtccgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaacaaggacctgtggcccctgctgctgagcatcatcttcatcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagtccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctaaagaagctgcgcgggacagctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccccgcctaccgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtctggcatcaacgctgtcttctattactccacgagcatcttcgagaag
gcgggggtgcagcagcctgtgtatgccaccattggctccggtatcgtcaacacggccttc
actgtcgtgtcgctgtttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctcgctggcatggcgggttgtgccatactcatgaccatcgcgctagcactgctggagcag
ctaccctggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtgggtcctggccccatcccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgccgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

KEGG   Homo sapiens (human): 7422Help
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06225  HIF-1 signaling
nt06262  Pancreatic cancer
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
Disease
H01456  Diabetic nephropathy
H01457  Diabetic retinopathy
H01459  Diabetic neuropathy
H01529  Avascular necrosis of femoral head
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Abicipar pegol: D11517
Aflibercept: D09574
Aflibercept beta: D10819
Bevacizumab: D06409
Bevasiranib sodium: D08874
Brolucizumab: D11083
Dilpacimab: D11642
Faricimab: D11516
Navicixizumab: D11126
Pegaptanib: D05386
Ranibizumab: D05697
Vanucizumab: D11244
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7422 (VEGFA)
   04015 Rap1 signaling pathway
    7422 (VEGFA)
   04010 MAPK signaling pathway
    7422 (VEGFA)
   04370 VEGF signaling pathway
    7422 (VEGFA)
   04066 HIF-1 signaling pathway
    7422 (VEGFA)
   04151 PI3K-Akt signaling pathway
    7422 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7422 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7422 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7422 (VEGFA)
   05206 MicroRNAs in cancer
    7422 (VEGFA)
   05205 Proteoglycans in cancer
    7422 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    7422 (VEGFA)
   05211 Renal cell carcinoma
    7422 (VEGFA)
   05219 Bladder cancer
    7422 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7422 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7422 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7422 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    7422 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7422 (VEGFA)
   05165 Human papillomavirus infection
    7422 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    7422 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7422 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7422 (VEGFA)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   7422 (VEGFA)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   7422 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF
Motif
Other DBs
NCBI-GeneID: 7422
NCBI-ProteinID: NP_001165094
OMIM: 192240
HGNC: 12680
Ensembl: ENSG00000112715
Vega: OTTHUMG00000014745
Pharos: P15692(Tclin)
UniProt: P15692 A0A024RD33
LinkDB All DBs
Structure
PDB: 

Position
6p21.1
AA seq 232 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

KEGG   Homo sapiens (human): 7040Help
Entry
7040              CDS       T01001                                 

Gene name
TGFB1, CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06118  TGFB signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06218  TGFB signaling
nt06225  HIF-1 signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06276  Chronic myeloid leukemia
  Element
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00531  HBV HBx to TGF-beta signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00434  Camurati-Engelmann disease
H01593  Osteoporosis
Drug target
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7040 (TGFB1)
   04350 TGF-beta signaling pathway
    7040 (TGFB1)
   04390 Hippo signaling pathway
    7040 (TGFB1)
   04068 FoxO signaling pathway
    7040 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7040 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7040 (TGFB1)
   04218 Cellular senescence
    7040 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    7040 (TGFB1)
   04672 Intestinal immune network for IgA production
    7040 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7040 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7040 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7040 (TGFB1)
   05205 Proteoglycans in cancer
    7040 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    7040 (TGFB1)
   05212 Pancreatic cancer
    7040 (TGFB1)
   05225 Hepatocellular carcinoma
    7040 (TGFB1)
   05226 Gastric cancer
    7040 (TGFB1)
   05220 Chronic myeloid leukemia
    7040 (TGFB1)
   05211 Renal cell carcinoma
    7040 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7040 (TGFB1)
   05321 Inflammatory bowel disease (IBD)
    7040 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    7040 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    7040 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7040 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7040 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    7040 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7040 (TGFB1)
   05161 Hepatitis B
    7040 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7040 (TGFB1)
   05144 Malaria
    7040 (TGFB1)
   05145 Toxoplasmosis
    7040 (TGFB1)
   05140 Leishmaniasis
    7040 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    7040 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7040 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7040 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7040 (TGFB1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   7040 (TGFB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7040 (TGFB1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   7040 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Sterile
Motif
Other DBs
NCBI-GeneID: 7040
NCBI-ProteinID: NP_000651
OMIM: 190180
HGNC: 11766
Ensembl: ENSG00000105329
Vega: OTTHUMG00000182760
Pharos: P01137(Tchem)
UniProt: P01137 A0A499FJK2
LinkDB All DBs
Structure
PDB: 

Position
19q13.2
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Homo sapiens (human): 7042Help
Entry
7042              CDS       T01001                                 

Gene name
TGFB2, G-TSF, LDS4, TGF-beta2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06118  TGFB signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06218  TGFB signaling
nt06225  HIF-1 signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06276  Chronic myeloid leukemia
  Element
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00531  HBV HBx to TGF-beta signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00800  Loeys-Dietz syndrome
Drug target
Belagenpumatucel-L: D06563
Fresolimumab: D09620
Trabedersen: D10203
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7042 (TGFB2)
   04350 TGF-beta signaling pathway
    7042 (TGFB2)
   04390 Hippo signaling pathway
    7042 (TGFB2)
   04068 FoxO signaling pathway
    7042 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7042 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7042 (TGFB2)
   04218 Cellular senescence
    7042 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7042 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7042 (TGFB2)
   05206 MicroRNAs in cancer
    7042 (TGFB2)
   05205 Proteoglycans in cancer
    7042 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    7042 (TGFB2)
   05212 Pancreatic cancer
    7042 (TGFB2)
   05225 Hepatocellular carcinoma
    7042 (TGFB2)
   05226 Gastric cancer
    7042 (TGFB2)
   05220 Chronic myeloid leukemia
    7042 (TGFB2)
   05211 Renal cell carcinoma
    7042 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7042 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    7042 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    7042 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    7042 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7042 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    7042 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7042 (TGFB2)
   05161 Hepatitis B
    7042 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7042 (TGFB2)
   05144 Malaria
    7042 (TGFB2)
   05145 Toxoplasmosis
    7042 (TGFB2)
   05140 Leishmaniasis
    7042 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    7042 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7042 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7042 (TGFB2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7042 (TGFB2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   7042 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 7042
NCBI-ProteinID: NP_003229
OMIM: 190220
HGNC: 11768
Ensembl: ENSG00000092969
Vega: OTTHUMG00000039521
Pharos: P61812(Tbio)
UniProt: P61812 Q59EG9
LinkDB All DBs
Structure
PDB: 

Position
1q41
AA seq 414 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgttcgatttgacgtctcagcaatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggattgagctatatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaacaagagcagaaggcgaatggctctcc
ttcgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgctgcacttttgtaccatctaataattacatcatccca
aataaaagtgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccggcggaag
aagcgtgctttggatgcggcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatctagggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccgtatttatggagttcagacactcagcac
agcagggtcctgagcttatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaagatttagaacctctaaccattctctactacattggcaaaacacccaagatt
gaacagctttctaatatgattgtaaagtcttgcaaatgcagctaa

KEGG   Homo sapiens (human): 7043Help
Entry
7043              CDS       T01001                                 

Gene name
TGFB3, ARVD, ARVD1, LDS5, RNHF, TGF-beta3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06118  TGFB signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06218  TGFB signaling
nt06225  HIF-1 signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06276  Chronic myeloid leukemia
  Element
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00531  HBV HBx to TGF-beta signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00293  Arrhythmogenic right ventricular cardiomyopathy
H00431  Ossification of the posterior longitudinal ligament of spine
H00800  Loeys-Dietz syndrome
H01385  Rienhoff syndrome
Drug target
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7043 (TGFB3)
   04350 TGF-beta signaling pathway
    7043 (TGFB3)
   04390 Hippo signaling pathway
    7043 (TGFB3)
   04068 FoxO signaling pathway
    7043 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7043 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7043 (TGFB3)
   04218 Cellular senescence
    7043 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7043 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    7043 (TGFB3)
   05212 Pancreatic cancer
    7043 (TGFB3)
   05225 Hepatocellular carcinoma
    7043 (TGFB3)
   05226 Gastric cancer
    7043 (TGFB3)
   05220 Chronic myeloid leukemia
    7043 (TGFB3)
   05211 Renal cell carcinoma
    7043 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7043 (TGFB3)
   05321 Inflammatory bowel disease (IBD)
    7043 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    7043 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    7043 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7043 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    7043 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7043 (TGFB3)
   05161 Hepatitis B
    7043 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7043 (TGFB3)
   05144 Malaria
    7043 (TGFB3)
   05145 Toxoplasmosis
    7043 (TGFB3)
   05140 Leishmaniasis
    7043 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    7043 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7043 (TGFB3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7043 (TGFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 7043
NCBI-ProteinID: NP_001316868
OMIM: 190230
HGNC: 11769
Ensembl: ENSG00000119699
Vega: OTTHUMG00000171489
Pharos: P10600(Tbio)
UniProt: P10600 A5YM40
LinkDB All DBs
Structure
PDB: 

Position
14q24.3
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccctaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctattccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagaggaagaagcgg
gctttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaagtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

KEGG   Homo sapiens (human): 5155Help
Entry
5155              CDS       T01001                                 

Gene name
PDGFB, IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  Jak-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06220  Calcium signaling
nt06224  CXCR signaling
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
nt06273  Glioma
  Element
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H00042  Glioma
H01574  Familial idiopathic basal ganglia calcification
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5155 (PDGFB)
   04015 Rap1 signaling pathway
    5155 (PDGFB)
   04010 MAPK signaling pathway
    5155 (PDGFB)
   04630 Jak-STAT signaling pathway
    5155 (PDGFB)
   04072 Phospholipase D signaling pathway
    5155 (PDGFB)
   04151 PI3K-Akt signaling pathway
    5155 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5155 (PDGFB)
   04540 Gap junction
    5155 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5155 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5155 (PDGFB)
   05206 MicroRNAs in cancer
    5155 (PDGFB)
   05231 Choline metabolism in cancer
    5155 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    5155 (PDGFB)
   05218 Melanoma
    5155 (PDGFB)
   05211 Renal cell carcinoma
    5155 (PDGFB)
   05215 Prostate cancer
    5155 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5155 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    5155 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5155 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5155 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5155 (PDGFB)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   5155 (PDGFB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   5155 (PDGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF PDGF_N
Motif
Other DBs
NCBI-GeneID: 5155
NCBI-ProteinID: NP_002599
OMIM: 190040
HGNC: 8800
Ensembl: ENSG00000100311
Vega: OTTHUMG00000151029
Pharos: P01127(Tchem)
UniProt: P01127 A0A384NYY3
LinkDB All DBs
Structure
PDB: 

Position
22q13.1
AA seq 241 aa AA seqDB search
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccattgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

KEGG   Homo sapiens (human): 7039Help
Entry
7039              CDS       T01001                                 

Gene name
TGFA, TFGA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06220  Calcium signaling
nt06225  HIF-1 signaling
nt06260  Colorectal cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00231  TGFA-EGFR-PI3K signaling pathway
N00232  TGFA-overexpression to PI3K signaling pathway
Disease
H00020  Colorectal cancer
H00048  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7039 (TGFA)
   04010 MAPK signaling pathway
    7039 (TGFA)
   04012 ErbB signaling pathway
    7039 (TGFA)
   04151 PI3K-Akt signaling pathway
    7039 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    7039 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7039 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    7039 (TGFA)
   05212 Pancreatic cancer
    7039 (TGFA)
   05225 Hepatocellular carcinoma
    7039 (TGFA)
   05214 Glioma
    7039 (TGFA)
   05211 Renal cell carcinoma
    7039 (TGFA)
   05215 Prostate cancer
    7039 (TGFA)
   05223 Non-small cell lung cancer
    7039 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    7039 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF EGF_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 7039
NCBI-ProteinID: NP_003227
OMIM: 190170
HGNC: 11765
Ensembl: ENSG00000163235
Vega: OTTHUMG00000129669
Pharos: P01135(Tbio)
UniProt: P01135
LinkDB All DBs
Structure
PDB: 

Position
2p13.3
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgctctgggtattgtgttggctgcgtgc
caggccttggagaacagcacgtccccgctgagtgcagacccgcccgtggctgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system