KEGG   Homo sapiens (human): 6514Help
Entry
6514              CDS       T01001                                 

Gene name
SLC2A2, GLUT2
Definition
(RefSeq) solute carrier family 2 member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04917  Prolactin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04950  Maturity onset diabetes of the young
hsa04973  Carbohydrate digestion and absorption
hsa05230  Central carbon metabolism in cancer
Disease
H00069  Glycogen storage disease
H01947  Fanconi-Bickel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6514 (SLC2A2)
   04922 Glucagon signaling pathway
    6514 (SLC2A2)
   04917 Prolactin signaling pathway
    6514 (SLC2A2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    6514 (SLC2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    6514 (SLC2A2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    6514 (SLC2A2)
   04950 Maturity onset diabetes of the young
    6514 (SLC2A2)
   04931 Insulin resistance
    6514 (SLC2A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6514 (SLC2A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   6514 (SLC2A2)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6514 (SLC2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 OATP ParB HlyE
Motif
Other DBs
NCBI-GeneID: 6514
NCBI-ProteinID: NP_000331
OMIM: 138160
HGNC: 11006
Ensembl: ENSG00000163581
Vega: OTTHUMG00000158997
Pharos: P11168(Tbio)
UniProt: P11168
LinkDB All DBs
Position
3q26.2
AA seq 524 aa AA seqDB search
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagataaggtcactgggaccctggttttcactgtcatcactgctgtgctgggt
tccttccagtttggatatgacattggtgtgatcaatgcacctcaacaggtaataatatct
cactatagacatgttttgggtgttccactggatgaccgaaaagctatcaacaactatgtt
atcaacagtacagatgaactgcccacaatctcatactcaatgaacccaaaaccaacccct
tgggctgaggaagagactgtggcagctgctcaactaatcaccatgctctggtccctgtct
gtatccagctttgcagttggtggaatgactgcatcattctttggtgggtggcttggggac
acacttggaagaatcaaagccatgttagtagcaaacattctgtcattagttggagctctc
ttgatggggttttcaaaattgggaccatctcatatacttataattgctggaagaagcata
tcaggactatattgtgggctaatttcaggcctggttcctatgtatatcggtgaaattgct
ccaaccgctctcaggggagcacttggcacttttcatcagctggccatcgtcacgggcatt
cttattagtcagattattggtcttgaatttatcttgggcaattatgatctgtggcacatc
ctgcttggcctgtctggtgtgcgagccatccttcagtctctgctactctttttctgtcca
gaaagccccagatacctttacatcaagttagatgaggaagtcaaagcaaaacaaagcttg
aaaagactcagaggatatgatgatgtcaccaaagatattaatgaaatgagaaaagaaaga
gaagaagcatcgagtgagcagaaagtctctataattcagctcttcaccaattccagctac
cgacagcctattctagtggcactgatgctgcatgtggctcagcaattttccggaatcaat
ggcattttttactactcaaccagcatttttcagacggctggtatcagcaaacctgtttat
gcaaccattggagttggcgctgtaaacatggttttcactgctgtctctgtattccttgtg
gagaaggcagggcgacgttctctctttctaattggaatgagtgggatgtttgtttgtgcc
atcttcatgtcagtgggacttgtgctgctgaataagttctcttggatgagttatgtgagc
atgatagccatcttcctctttgtcagcttctttgaaattgggccaggcccgatcccctgg
ttcatggtggctgagtttttcagtcaaggaccacgtcctgctgctttagcaatagctgca
ttcagcaattggacctgcaatttcattgtagctctgtgtttccagtacattgcggacttc
tgtggaccttatgtgtttttcctctttgctggagtgctcctggcctttaccctgttcaca
ttttttaaagttccagaaaccaaaggaaagtcttttgaggaaattgctgcagaattccaa
aagaagagtggctcagcccacaggccaaaagctgctgtagaaatgaaattcctaggagct
acagagactgtgtaa

DBGET integrated database retrieval system