KEGG   Homo sapiens (human): 6518
Entry
6518              CDS       T01001                                 

Gene name
SLC2A5, GLUT-5, GLUT5
Definition
(RefSeq) solute carrier family 2 member 5
  KO
K08143  MFS transporter, SP family, solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    6518 (SLC2A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6518 (SLC2A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   6518 (SLC2A5)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6518 (SLC2A5)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 6518
NCBI-ProteinID: NP_001315548
OMIM: 138230
HGNC: 11010
Ensembl: ENSG00000142583
Vega: OTTHUMG00000001771
Pharos: P22732(Tbio)
UniProt: P22732
LinkDB
Position
1p36.23
AA seq 501 aa
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW
DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT
AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK
VSEVYPEKEELKELPPVTSEQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggagcaacaggatcagagcatgaaggaagggaggctgacgcttgtgcttgccctggca
accctgatagctgcctttgggtcatccttccagtatgggtacaacgtggctgctgtcaac
tccccagcactgctcatgcaacaattttacaatgagacttactatggtaggaccggtgaa
ttcatggaagacttccccttgacgttgctgtggtctgtaaccgtgtccatgtttccattt
ggagggtttatcggatccctcctggtcggccccttggtgaataaatttggcagaaaaggg
gccttgctgttcaacaacatattttctatcgtgcctgcgatcttaatgggatgcagcaga
gtcgccacatcatttgagcttatcattatttccagacttttggtgggaatatgtgcaggt
gtatcttccaacgtggtccccatgtacttaggggagctggcccctaaaaacctgcggggg
gctctcggggtggtgccccagctcttcatcactgttggcatccttgtggcccagatcttt
ggtcttcggaatctccttgcaaacgtagatggctggccgatcctgctggggctgaccggg
gtccccgcggcgctgcagctccttctgctgcccttcttccccgagagccccaggtacctg
ctgattcagaagaaagacgaagcggccgccaagaaagccctacagacgctgcgcggctgg
gactctgtggacagggaggtggccgagatccggcaggaggatgaggcagagaaggccgcg
ggcttcatctccgtgctgaagctgttccggatgcgctcgctgcgctggcagctgctgtcc
atcatcgtcctcatgggcggccagcagctgtcgggcgtcaacgctatctactactacgcg
gaccagatctacctgagcgccggcgtgccggaggagcacgtgcagtacgtgacggccggc
accggggccgtgaacgtggtcatgaccttctgcgccgtgttcgtggtggagctcctgggt
cggaggctgctgctgctgctgggcttctccatctgcctcatagcctgctgcgtgctcact
gcagctctggcactgcaggacacagtgtcctggatgccatacatcagcatcgtctgtgtc
atctcctacgtcataggacatgccctcgggcccagtcccatacccgcgctgctcatcact
gagatcttcctgcagtcctctcggccatctgccttcatggtggggggcagtgtgcactgg
ctctccaacttcaccgtgggcttgatcttcccgttcatccaggagggcctcggcccgtac
agcttcattgtcttcgccgtgatctgcctcctcaccaccatctacatcttcttgattgtc
ccggagaccaaggccaagacgttcatagagatcaaccagattttcaccaagatgaataag
gtgtctgaagtgtacccggaaaaggaggaactgaaagagcttccacctgtcacttcggaa
cagtga

DBGET integrated database retrieval system