KEGG   Homo sapiens (human): 6523Help
Entry
6523              CDS       T01001                                 

Gene name
SLC5A1, D22S675, NAGT, SGLT1
Definition
(RefSeq) solute carrier family 5 member 1
  KO
K14158  solute carrier family 5 (sodium/glucose cotransporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04973  Carbohydrate digestion and absorption
hsa04976  Bile secretion
hsa04978  Mineral absorption
Disease
H01261  Congenital glucose-galactose malabsorption
Drug target
Sotagliflozin: D10669
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    6523 (SLC5A1)
   04973 Carbohydrate digestion and absorption
    6523 (SLC5A1)
   04978 Mineral absorption
    6523 (SLC5A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6523 (SLC5A1)
   04147 Exosome [BR:hsa04147]
    6523 (SLC5A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   6523 (SLC5A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6523 (SLC5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF TadF
Motif
Other DBs
NCBI-GeneID: 6523
NCBI-ProteinID: NP_000334
OMIM: 182380
HGNC: 11036
Ensembl: ENSG00000100170
Vega: OTTHUMG00000030768
Pharos: P13866(Tchem)
UniProt: P13866
LinkDB All DBs
Position
22q12.3
AA seq 664 aa AA seqDB search
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagcacctggagccccaagaccaccgcggtcacccggcctgttgagacccac
gagctcattcgcaatgcagccgatatctccatcatcgttatctacttcgtggtagtgatg
gccgtcggactgtgggctatgttttccaccaatcgtgggactgttggaggcttcttcctg
gcaggccgaagtatggtgtggtggccgattggagcctccctctttgctagtaacattgga
agtggccactttgtggggctggccgggactggggcagcttcaggcatcgccattggaggc
tttgaatggaatgccctggttttggtggttgtgctgggctggctgtttgtccccatctat
attaaggctggggtggtgacaatgccagagtacctgaggaagcggtttggaggccagcgg
atccaggtctacctttcccttctgtccctgctgctctacattttcaccaagatctcggca
gacatcttctcgggggccatattcatcaatctggccttaggcctgaatctgtatttagcc
atctttctcttattggcaatcactgccctttacacaattacagggggcctggcggcggtg
atttacacggacaccttgcagacggtgatcatgctggtggggtctttaatcctgactggg
tttgcttttcacgaagtgggaggctatgacgccttcatggaaaagtacatgaaagccatt
ccaaccatagtgtctgatggcaacaccacctttcaggaaaaatgctacactccaagggcc
gactccttccacatcttccgagatcccctcacgggagacctcccatggcctgggttcatc
tttgggatgtccatccttaccttgtggtactggtgcacagatcaggtcattgtgcagcgc
tgcctctcagccaagaatatgtctcacgtgaagggtggctgcatcctgtgtgggtatcta
aagctgatgcccatgttcatcatggtgatgccaggaatgatcagccgcattctgtacaca
gaaaaaattgcctgtgtcgtcccttcagaatgtgagaaatattgcggtaccaaggttggc
tgtaccaacatcgcctatccaaccttagtggtggagctcatgcccaatggactgcgaggc
ctgatgctatcagtcatgctggcctccctcatgagctccctgacctccatcttcaacagc
gccagcaccctcttcaccatggacatctacgccaaggtccgcaagagagcatctgagaaa
gagctcatgattgccggaaggttgtttatcctggtgctgattggcatcagcatcgcctgg
gtgcccattgtgcagtcagcacaaagtgggcaactcttcgattacatccagtccatcacc
agttacttgggaccacccattgcggctgtcttcctgcttgctattttctggaagagagtc
aatgagccaggagccttttggggactgatcctaggacttctgattgggatttcacgtatg
attactgagtttgcttatggaaccgggagctgcatggagcccagcaactgtcccacgatt
atctgtggggtgcactacttgtactttgccattatcctcttcgccatttctttcatcacc
atcgtggtcatctccctcctcaccaaacccattccggatgtgcatctctaccgtctgtgt
tggagcctgcgcaacagcaaagaggagcgtattgacctggatgcggaagaggagaacatc
caagaaggccctaaggagaccattgaaatagaaacacaagttcctgagaagaaaaaagga
atcttcaggagagcctatgacctattttgtgggctagagcagcacggtgcacccaagatg
actgaggaagaggagaaagccatgaagatgaagatgacggacacctctgagaagcctttg
tggaggacagtgttgaacgtcaatggcatcatcctggtgaccgtggctgtcttttgccat
gcatattttgcctga

DBGET integrated database retrieval system