KEGG   Homo sapiens (human): 6528
Entry
6528              CDS       T01001                                 

Gene name
SLC5A5, NIS, TDH1
Definition
(RefSeq) solute carrier family 5 member 5
  KO
K14385  solute carrier family 5 (sodium/iodide cotransporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
Network
nt06322  TRH-TSH-TH signaling
  Element
N00786  Transport of iodide
N00787  Mutation-inactivated NIS to transport of iodide
N00788  Mutation-inactivated PDS to transport of iodide
Disease
H00251  Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    6528 (SLC5A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6528 (SLC5A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   6528 (SLC5A5)
SSDB
Motif
Pfam: SSF NdhL
Other DBs
NCBI-GeneID: 6528
NCBI-ProteinID: NP_000444
OMIM: 601843
HGNC: 11040
Ensembl: ENSG00000105641
Vega: OTTHUMG00000183447
Pharos: Q92911(Tbio)
UniProt: Q92911
LinkDB
Position
19p13.11
AA seq 643 aa
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVG
LSLSASFMSAVQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEY
LEMRFSRAVRLCGTLQYIVATMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTA
VGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSRINLMDFNPDPRS
RYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAACCG
IVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSIN
AMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSA
ARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTV
LCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKK
PPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggaggccgtggagaccggggaacggcccaccttcggagcctgggactacggggtcttt
gccctcatgctcctggtgtccactggcatcgggctgtgggtcgggctggctcggggcggg
cagcgcagcgctgaggacttcttcaccgggggccggcgcctggcggccctgcccgtgggc
ctgtcgctgtctgccagcttcatgtcggccgtgcaggtgctgggcgtgccgtcggaggcc
tatcgctatggcctcaagttcctctggatgtgcctgggccagcttctgaactcggtcctc
accgccctgctcttcatgcccgtcttctaccgcctgggcctcaccagcacctacgagtac
ctggagatgcgcttcagccgcgcagtgcggctctgcgggactttgcagtacattgtagcc
acgatgctgtacaccggcatcgtaatctacgcaccggccctcatcctgaaccaagtgacc
gggctggacatctgggcgtcgctcctgtccaccggaattatctgcaccttctacacggct
gtgggcggcatgaaggctgtggtctggactgatgtgttccaggtcgtggtgatgctaagt
ggcttctgggttgtcctggcacgcggtgtcatgcttgtgggcgggccccgccaggtgctc
acgctggcccagaaccactcccggatcaacctcatggactttaaccctgacccgaggagc
cgctatacattctggacttttgtggtgggtggcacgttggtgtggctctccatgtatggc
gtgaaccaggcgcaggtgcagcgctacgtggcttgccgcacagagaagcaggccaagctg
gccctgctcatcaaccaggtcggcctgttcctgatcgtgtccagcgctgcctgctgtggc
atcgtcatgtttgtgttctacactgactgcgaccctctcctcctggggcgcatctctgcc
ccagaccagtacatgcctctgctggtgctggacatcttcgaagatctgcctggagtcccc
gggcttttcctggcctgtgcttacagtggcaccctcagcacagcatccaccagcatcaat
gctatggctgcagtcactgtagaagacctcatcaaacctcggctgcggagcctggcaccc
aggaaactcgtgattatctccaaggggctctcactcatctacggatcggcctgtctcacc
gtggcagccctgtcctcactgctcggaggaggtgtccttcagggctccttcaccgtcatg
ggagtcatcagcggccccctgctgggagccttcatcttgggaatgttcctgccggcctgc
aacacaccgggcgtcctcgcgggactaggcgcgggcttggcgctgtcgctgtgggtggcc
ttgggcgccacgctgtacccacccagcgagcagaccatgagggtcctgccatcgtcggct
gcccgctgcgtggctctctcagtcaacgcctctggcctcctggacccggctctcctccct
gctaacgactccagcagggcccccagctcaggaatggacgccagccgacccgccttagct
gacagcttctatgccatctcctatctctattacggtgccctgggcacgctgaccactgtg
ctgtgcggagccctcatcagctgcctgacaggccccaccaagcgcagcaccctggccccg
ggattgttgtggtgggacctcgcacggcagacagcatcagtggcccccaaggaagaagtg
gccatcctggatgacaacttggtcaagggtcctgaagaactccccactggaaacaagaag
ccccctggcttcctgcccaccaatgaggatcgtctgtttttcttggggcagaaggagctg
gagggggctggctcttggaccccctgtgttggacatgatggtggtcgagaccagcaggag
acaaacctctga

DBGET integrated database retrieval system