KEGG   Homo sapiens (human): 6531Help
Entry
6531              CDS       T01001                                 

Gene name
SLC6A3, DAT, DAT1, PKDYS, PKDYS1
Definition
(RefSeq) solute carrier family 6 member 3
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Drug target
Amfepramone (DG00104): D03801 D07444
Amfetamine (DG00966): D02074 D07445
Amfonelic acid: D02897
Amitifadine (DG01386): D10088 D10089
Armodafinil: D03215
Brasofensine maleate: D03153
Bupropion (DG00957): D00817 D07591 D07938
Centanafadine (DG01858): D10697 D10698
Cocaine (DG00808): D00110 D02182
Dasotraline (DG01989): D10700 D10870
Dexamfetamine (DG00967): D02078 D03740
Dexmethylphenidate (DG00972): D03721 D07806
Iodine ioflupane (123I): D10014
Mazindol: D00367
Metamfetamine (DG00968): D02242 D08187
Methylphenidate (DG00969): D01296 D04999
Phentermine (DG00102): D05458 D05459
Pyrovalerone hydrochloride: D05663
Sibutramine (DG00108): D02571 D08513
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    6531 (SLC6A3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    6531 (SLC6A3)
  09164 Substance dependence
   05030 Cocaine addiction
    6531 (SLC6A3)
   05031 Amphetamine addiction
    6531 (SLC6A3)
   05034 Alcoholism
    6531 (SLC6A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6531 (SLC6A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6531 (SLC6A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 6531
NCBI-ProteinID: NP_001035
OMIM: 126455
HGNC: 11049
Ensembl: ENSG00000142319
Vega: OTTHUMG00000131016
Pharos: Q01959(Tclin)
UniProt: Q01959
LinkDB All DBs
Position
5p15.33
AA seq 620 aa AA seqDB search
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggactcatgtcttccgtggtggccccggctaaggag
cccaatgccgtgggcccgaaggaggtggagctcatccttgtcaaggagcagaacggagtg
cagctcaccagctccaccctcaccaacccgcggcagagccccgtggaggcccaggatcgg
gagacctggggcaagaagatcgactttctcctgtccgtcattggctttgctgtggacctg
gccaacgtctggcggttcccctacctgtgctacaaaaatggtggcggtgccttcctggtc
ccctacctgctcttcatggtcattgctgggatgccacttttctacatggagctggccctc
ggccagttcaacagggaaggggccgctggtgtctggaagatctgccccatactgaaaggt
gtgggcttcacggtcatcctcatctcactgtatgtcggcttcttctacaacgtcatcatc
gcctgggcgctgcactatctcttctcctccttcaccacggagctcccctggatccactgc
aacaactcctggaacagccccaactgctcggatgcccatcctggtgactccagtggagac
agctcgggcctcaacgacacttttgggaccacacctgctgccgagtactttgaacgtggc
gtgctgcacctccaccagagccatggcatcgacgacctggggcctccgcggtggcagctc
acagcctgcctggtgctggtcatcgtgctgctctacttcagcctctggaagggcgtgaag
acctcagggaaggtggtatggatcacagccaccatgccatacgtggtcctcactgccctg
ctcctgcgtggggtcaccctccctggagccatagacggcatcagagcatacctgagcgtt
gacttctaccggctctgcgaggcgtctgtttggattgacgcggccacccaggtgtgcttc
tccctgggcgtggggttcggggtgctgatcgccttctccagctacaacaagttcaccaac
aactgctacagggacgcgattgtcaccacctccatcaactccctgacgagcttctcctcc
ggcttcgtcgtcttctccttcctggggtacatggcacagaagcacagtgtgcccatcggg
gacgtggccaaggacgggccagggctgatcttcatcatctacccggaagccatcgccacg
ctccctctgtcctcagcctgggccgtggtcttcttcatcatgctgctcaccctgggtatc
gacagcgccatgggtggtatggagtcagtgatcaccgggctcatcgatgagttccagctg
ctgcacagacaccgtgagctcttcacgctcttcatcgtcctggcgaccttcctcctgtcc
ctgttctgcgtcaccaacggtggcatctacgtcttcacgctcctggaccattttgcagcc
ggcacgtccatcctctttggagtgctcatcgaagccatcggagtggcctggttctatggt
gttgggcagttcagcgacgacatccagcagatgaccgggcagcggcccagcctgtactgg
cggctgtgctggaagctggtcagcccctgctttctcctgttcgtggtcgtggtcagcatt
gtgaccttcagacccccccactacggagcctacatcttccccgactgggccaacgcgctg
ggctgggtcatcgccacatcctccatggccatggtgcccatctatgcggcctacaagttc
tgcagcctgcctgggtcctttcgagagaaactggcctacgccattgcacccgagaaggac
cgtgagctggtggacagaggggaggtgcgccagttcacgctccgccactggctcaaggtg
tag

DBGET integrated database retrieval system