KEGG   Homo sapiens (human): 653519Help
Entry
653519            CDS       T01001                                 

Gene name
GPR89A, GPHR, GPR89, GPR89B, SH120, UNQ192
Definition
(RefSeq) G protein-coupled receptor 89A
  KO
K22193  golgi pH regulator
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    653519 (GPR89A)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   653519 (GPR89A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABA_GPCR GPHR_N NPCC
Motif
Other DBs
NCBI-GeneID: 653519
NCBI-ProteinID: NP_001091081
OMIM: 612821
HGNC: 31984
Ensembl: ENSG00000117262
Vega: OTTHUMG00000013738
Pharos: B7ZAQ6(Tdark) P0CG08(Tdark)
UniProt: B7ZAQ6 P0CG08 X5D7G6
LinkDB All DBs
Position
1q21.1
AA seq 455 aa AA seqDB search
MSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIF
EILGVLNSSSRYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTF
MYFFWKLGDPFPILSPKHGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRN
VTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASG
SENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWK
IFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLL
ITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFN
FYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMAP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcctcatcgactccagcatcatgattacctcccagatactattttttggattt
gggtggcttttcttcatgcgccaattgtttaaagactatgagatacgtcagtatgttgta
caggtgatcttctccgtgacgtttgcattttcttgcaccatgtttgagctcatcatcttt
gaaatcttaggagtattgaatagcagctcccgttattttcactggaaaatgaacctgtgt
gtaattctgctgatcctggttttcatggtgcctttttacattggctattttattgtgagc
aatatccgactactgcataaacaacgactgcttttttcctgtctcttatggctgaccttt
atgtatttcttctggaaactaggagatccctttcccattctcagcccaaaacatgggatc
ttatccatagaacagctcatcagccgggttggtgtgattggagtgactctcatggctctt
ctttctggatttggtgctgtcaactgcccatacacttacatgtcttacttcctcaggaat
gtgactgacacggatattctagccctggaacggcgactgctgcaaaccatggatatgatc
ataagcaaaaagaaaaggatggcaatggcacggagaacaatgttccagaagggggaagtg
cataacaaaccatcaggtttctggggaatgataaaaagtgttaccacttcagcatcagga
agtgaaaatcttactcttattcaacaggaagtggatgctttggaagaattaagcaggcag
ctttttctggaaacagctgatctatatgctaccaaggagagaatagaatactccaaaacc
ttcaaggggaaatattttaattttcttggttactttttctctatttactgtgtttggaaa
attttcatggctaccatcaatattgtttttgatcgagttgggaaaacggatcctgtcaca
agaggcattgagatcactgtgaattatctgggaatccaatttgatgtgaagttttggtcc
caacacatttccttcattcttgttggaataatcatcgtcacatccatcagaggattgctg
atcactcttaccaagttcttttatgccatctctagcagtaagtcctccaatgtcattgtc
ctgctattagcacagataatgggcatgtactttgtctcctctgtgctgctgatccgaatg
agtatgcctttagaataccgcaccataatcactgaagtccttggagaactgcagttcaac
ttctatcaccgttggtttgatgtgatcttcctggtcagcgctctctctagcatactcttc
ctctatttggctcacaaacaggcaccagagaagcaaatggcaccttga

DBGET integrated database retrieval system