KEGG   Homo sapiens (human): 6538
Entry
6538              CDS       T01001                                 

Gene name
SLC6A11, GAT-3, GAT3, GAT4
Definition
(RefSeq) solute carrier family 6 member 11
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    6538 (SLC6A11)
   04721 Synaptic vesicle cycle
    6538 (SLC6A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6538 (SLC6A11)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6538 (SLC6A11)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 6538
NCBI-ProteinID: NP_055044
OMIM: 607952
HGNC: 11044
Ensembl: ENSG00000132164
Vega: OTTHUMG00000129718
Pharos: P48066(Tbio)
UniProt: P48066
LinkDB
Position
3p25.3
AA seq 632 aa
MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKY
NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgacggcggagaaggcgctgcccctgggcaatgggaaggctgctgaggaggcgcgggag
tccgaggcgccgggtggcggctgcagcagcgggggcgcggcgcccgcgcgccacccgcgc
gtcaagcgcgacaaggcggtccacgagcgcggccactggaacaacaaggtggagttcgtg
ctgagcgtggccggggagatcattgggctgggcaacgtgtggcgcttcccctacctgtgc
tacaagaacggaggaggggcattcctgattccctacgtggtgttttttatttgctgtgga
attcctgtttttttcctggagacagctctggggcagttcacaagtgaaggtggcattacg
tgttggaggaaagtttgccctttatttgaaggcattggctatgcaacacaggtgattgag
gcccatctgaatgtgtactacatcatcatcctggcatgggccattttttacctgagcaac
tgcttcactactgagctaccctgggctacctgtgggcatgagtggaacacagagaattgt
gtggagttccagaaactgaatgtgagcaactacagccatgtgtctctgcagaatgccacc
tcccctgtcatggagttttgggagcaccgggtcctggccatctctgacgggatcgagcac
atcgggaaccttcgctgggagctggccttgtgtctcttggcagcctggaccatctgttac
ttctgtatctggaaggggaccaagtctacaggaaaggttgtatacgtgactgcgacattc
ccctacatcatgctgctgatcctcctgatacgaggggtcacgttgcccggggcctcagag
ggcatcaagttctacttgtaccctgacctctcccggctctccgacccccaggtctgggta
gatgctggaacgcagatctttttctcctatgccatttgcctgggctgtctgaccgctctg
ggaagttataacaattataacaacaactgctacagggactgcatcatgctctgttgcctg
aacagcggcaccagcttcgtggctgggtttgccatcttctcagtcctgggttttatggcg
tacgagcagggggtacccattgctgaggtggcagagtcaggccccggcctggcctttatt
gcgtaccccaaggcggtcaccatgatgcctctctccccgctgtgggccaccttgttcttc
atgatgctcatcttcctgggcctggacagccagtttgtgtgtgtggaaagcctggtgacc
gccgtggtggacatgtaccccaaggttttccggaggggttaccggcgggagctgctcatc
ctagccttgtctgttatctcctattttctgggcctcgtgatgttaacagagggtggcatg
tacatcttccagctctttgactcctatgccgccagtgggatgtgccttctcttcgtggcc
atctttgagtgcatctgcatcggctgggtgtatggaagcaaccggttctatgataacatt
gaagacatgattggctaccggccaccgtcgctcattaagtggtgctggatgatcatgacc
cctgggatctgcgcggggatcttcatcttcttcttgatcaagtacaagccactcaagtac
aacaacatctacacctacccagcctggggctatggcattggctggctcatggccctgtcc
tccatgctctgcatcccgctctggatctgcatcacagtgtggaagacggaggggacactg
cccgagaaactccagaagttgacgacccccagcacagatctgaaaatgcggggcaagctt
ggggtgagcccacggatggtgacagttaatgactgtgatgccaaactcaagagtgacggg
accatcgcagccatcacagagaaggagacgcacttctga

KEGG   Homo sapiens (human): 6540
Entry
6540              CDS       T01001                                 

Gene name
SLC6A13, GAT-2, GAT2, GAT3
Definition
(RefSeq) solute carrier family 6 member 13
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    6540 (SLC6A13)
   04721 Synaptic vesicle cycle
    6540 (SLC6A13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6540 (SLC6A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6540 (SLC6A13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 6540
NCBI-ProteinID: NP_057699
OMIM: 615097
HGNC: 11046
Ensembl: ENSG00000010379
Vega: OTTHUMG00000168053
Pharos: Q9NSD5(Tbio)
UniProt: Q9NSD5
LinkDB
Position
12p13.33
AA seq 602 aa
MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
IVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSLYRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES
HC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggatagcagggtctcaggcacaaccagtaatggagagacaaaaccagtgtatccagtc
atggaaaagaaggaggaagatggcaccctggagcgggggcactggaacaacaagatggag
tttgtgctgtcagtggctggggagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaaaaatgggggaggtgccttcttcatcccctacctcgtcttcctctttacc
tgtggcattcctgtcttccttctggagacagcactaggccagtacactagccagggaggc
gtcacagcctggaggaagatctgccccatctttgagggcattggctatgcctcccagatg
atcgtcatcctcctcaacgtctactacatcattgtgttggcctgggccctgttctacctc
ttcagcagcttcaccatcgacctgccctggggcggctgctaccatgagtggaacacagaa
cactgtatggagttccagaagaccaacggctccctgaatggtacctctgagaatgccacc
tctcctgtcatcgagttctgggagcggcgggtcttgaagatctctgatgggatccagcac
ctgggggccctgcgctgggagctggctctgtgcctcctgctggcctgggtcatctgctac
ttctgcatctggaagggggtgaagtccacaggcaaggtggtgtacttcacggccacattt
ccttacctcatgctggtggtcctgttaattcgaggggtgacgttgcctggggcagcccaa
ggaattcagttttacctgtacccaaacctcacgcgtctgtgggatccccaggtgtggatg
gatgcaggcacccagatattcttctccttcgccatctgtcttgggtgcctgacagccctg
ggcagctacaacaagtaccacaacaactgctacagggactgcatcgccctctgcttcctc
aacagcggcaccagctttgtggccggctttgccatcttctccatcctgggcttcatgtct
caggagcagggggtgcccatttctgaggtggccgagtcaggccctggcctggctttcatc
gcttacccgcgggctgtggtgatgctgcccttctctcctctctgggcctgctgtttcttc
ttcatggtcgttctcctgggactggatagccagtttgtgtgtgtagaaagcctggtgaca
gcgctggtggacatgtaccctcacgtgttccgcaagaagaaccggagggaagtcctcatc
cttggagtatctgtcgtctccttccttgtggggctgatcatgctcacagagggcggaatg
tacgtgttccagctctttgactactatgcggccagtggcatgtgcctcctgttcgtggcc
atcttcgagtccctctgtgtggcttgggtttacggagccaagcgcttctacgacaacatc
gaagacatgattgggtacaggccatggcctcttatcaaatactgttggctcttcctcaca
ccagctgtgtgcacagccacctttctcttctccctgataaagtacactccgctgacctac
aacaagaagtacacgtacccgtggtggggcgatgccctgggctggctcctggctctgtcc
tccatggtctgcattcctgcctggagcctctacagactcggaaccctcaagggccccttc
agagagagaatccgtcagctcatgtgcccagccgaggacctgccccagcggaacccagca
ggaccctcggctcccgccacccccaggacctcactgctcagactcacagagctagagtct
cactgctag

DBGET integrated database retrieval system