KEGG   Homo sapiens (human): 6541Help
Entry
6541              CDS       T01001                                 

Gene name
SLC7A1, ATRC1, CAT-1, ERR, HCAT1, REC1L
Definition
(RefSeq) solute carrier family 7 member 1
  KO
K13863  solute carrier family 7 (cationic amino acid transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    6541 (SLC7A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6541 (SLC7A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   6541 (SLC7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-GeneID: 6541
NCBI-ProteinID: NP_003036
OMIM: 104615
HGNC: 11057
Ensembl: ENSG00000139514
Vega: OTTHUMG00000016658
Pharos: P30825(Tbio)
UniProt: P30825 A0A024RDQ9
LinkDB All DBs
Position
13q12.3
AA seq 629 aa AA seqDB search
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLT
LGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEG
KPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA
YFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPR
VIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI
LSPKNMEPSKISGLIVNISTSLIAVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCA
VVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIY
FGYGLWHSEEASLDADQARTPDGNLDQCK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcaaagtcctgctcaacattgggcagcagatgctgcggcggaaggtggtggac
tgtagccgggaggagacgcggctgtctcgctgcctgaacacttttgatctggtggccctc
ggggtgggcagcacactgggtgctggtgtctacgtcctggctggagctgtggcccgtgag
aatgcaggccctgccattgtcatctccttcctgatcgctgcgctggcctcagtgctggct
ggcctgtgctatggcgagtttggtgctcgggtccccaagacgggctcagcttacctctac
agctatgtcaccgttggagagctctgggccttcatcaccggctggaacttaatcctctcc
tacatcatcggtacttcaagcgtagcgagggcctggagcgccaccttcgacgagctgata
ggcagacccatcggggagttctcacggacacacatgactctgaacgcccccggcgtgctg
gctgaaaaccccgacatattcgcagtgatcataattctcatcttgacaggacttttaact
cttggtgtgaaagagtcggccatggtcaacaaaatattcacttgtattaacgtcctggtc
ctgggcttcataatggtgtcaggatttgtgaaaggatcggttaaaaactggcagctcacg
gaggaggattttgggaacacatcaggccgtctctgtttgaacaatgacacaaaagaaggg
aagcccggtgttggtggattcatgcccttcgggttctctggtgtcctgtcgggggcagcg
acttgcttctatgccttcgtgggctttgactgcatcgccaccacaggtgaagaggtgaag
aacccacagaaggccatccccgtggggatcgtggcgtccctcttgatctgcttcatcgcc
tactttggggtgtcggctgccctcacgctcatgatgccctacttctgcctggacaataac
agccccctgcccgacgcctttaagcacgtgggctgggaaggtgccaagtacgcagtggcc
gtgggctccctctgcgctctttccgccagtcttctaggttccatgtttcccatgcctcgg
gttatctatgccatggctgaggatggactgctatttaaattcttagccaacgtcaatgat
aggaccaaaacaccaataatcgccacattagcctcgggtgccgttgctgctgtgatggcc
ttcctctttgacctgaaggacttggtggacctcatgtccattggcactctcctggcttac
tcgttggtggctgcctgtgtgttggtcttacggtaccagccagagcagcctaacctggta
taccagatggccagtacttccgacgagttagatccagcagaccaaaatgaattggcaagc
accaatgattcccagctgggctttttaccagaggcagagatgttctctttgaaaaccata
ctctcacccaaaaacatggagccttccaaaatctctgggctaattgtgaacatttcaacc
agcctcatagctgttctcatcatcaccttctgcattgtgaccgtgcttggaagggaggct
ctcaccaaaggggcgctgtgggcagtctttctgctcgcagggtctgccctcctctgtgcc
gtggtcacgggcgtcatctggaggcagcccgagagcaagaccaagctctcatttaaggtt
cccttcctgccagtgctccccatcctgagcatcttcgtgaacgtctatctcatgatgcag
ctggaccagggcacctgggtccggtttgctgtgtggatgctgataggcttcatcatctac
tttggctatggcctgtggcacagcgaggaggcgtccctggatgccgaccaagcaaggact
cctgacggcaacttggaccagtgcaagtga

DBGET integrated database retrieval system