KEGG   Homo sapiens (human): 6543Help
Entry
6543              CDS       T01001                                 

Gene name
SLC8A2, NCX2
Definition
(RefSeq) solute carrier family 8 member A2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04740  Olfactory transduction
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04974  Protein digestion and absorption
hsa04978  Mineral absorption
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6543 (SLC8A2)
   04020 Calcium signaling pathway
    6543 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    6543 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    6543 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    6543 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    6543 (SLC8A2)
   04978 Mineral absorption
    6543 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    6543 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    6543 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    6543 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6543 (SLC8A2)
   05414 Dilated cardiomyopathy (DCM)
    6543 (SLC8A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   6543 (SLC8A2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Others
   6543 (SLC8A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Motif
Other DBs
NCBI-GeneID: 6543
NCBI-ProteinID: NP_055878
OMIM: 601901
HGNC: 11069
Ensembl: ENSG00000118160
Vega: OTTHUMG00000183529
Pharos: Q9UPR5(Tbio)
UniProt: Q9UPR5
LinkDB All DBs
Position
19q13.32
AA seq 921 aa AA seqDB search
MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGP
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctggccttggtgggggtcacactcctcctggcggctcccccatgctccggg
gcagccaccccaaccccctccctgccgcctcccccggccaatgacagcgacaccagcaca
gggggctgccaggggtcctaccgctgccagccgggggtgctgctgcccgtgtgggagccc
gacgacccgtcgctgggtgacaaggcggcacgggcagtggtgtactttgtggccatggtc
tacatgtttctgggagtgtccatcatcgccgaccgtttcatggcggccatcgaggtcatc
acgtcaaaagagaaggagatcaccatcaccaaggccaacggtgagaccagcgtgggcacc
gttcgcatctggaatgagacggtgtccaacctcacgctcatggccctgggctcctccgca
cctgagatcctgctgtcagtcatcgaagtctgcggccacaacttccaggcgggtgagctg
ggcccaggcaccatcgtgggcagcgctgccttcaacatgtttgtggtcatcgccgtgtgc
atctacgtcatcccagccggcgagagccgcaagatcaagcacctgagagtcttctttgtc
actgcctcttggagcatcttcgcctatgtctggctttatctcatccttgctgttttttcc
cccggtgtggtccaggtgtgggaggcgctgctgaccctggtcttcttcccggtgtgcgtg
gtattcgcctggatggccgacaagcggctgctcttctacaagtacgtgtacaagcgctac
cgcaccgacccacgcagcggcatcatcataggcgccgagggcgaccccccgaagagcatc
gagctggacggcacgttcgtgggcgccgaggccccaggtgagctgggcggcctgggcccg
ggccccgccgaggcgcgcgagctggacgccagccgccgcgaggtcatccagatcctcaag
gacctcaagcagaagcacccggacaaggatctggagcagctggtgggcatcgccaactac
tacgcgctgctgcaccagcagaagagccgcgccttctaccgcatccaggccacgcggctg
atgaccggcgccgggaacgtgctgcgcagacacgcggcggacgcctcgcgcagggcggcg
ccggccgagggcgcgggcgaggacgaagacgacggcgccagccgcatcttcttcgagcct
agcctctaccactgcctggagaactgcggctccgtgctgctgtccgtcacgtgccagggc
ggcgagggcaacagcaccttctacgtggactaccgcactgaggacggctctgccaaggcg
ggctccgactacgagtacagcgagggcacgctggtgttcaaaccaggcgagacgcagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcatttcttcgtg
cggctgctgaacctgcgcgtgggcgacgcgcagggcatgttcgagccggacggcggcggg
cggcccaaggggcggctggtggcgccgctgctggccaccgtcaccatcctggacgacgac
cacgcaggcatcttctccttccaggaccgcctgctgcacgtgagcgagtgcatgggcacc
gtggacgtgcgcgtcgtgcgcagctcgggcgcgcgcggcaccgtgcgccttccctaccgc
acggtggacggcacggcgcgcggcggcggcgtgcactacgaggacgcgtgcggagagctg
gagtttggcgacgacgagaccatgaaaactcttcaggtgaagatagttgatgacgaggaa
tatgagaaaaaggataatttcttcattgagctgggccagccccagtggcttaagcgaggg
atttcagctctgctactcaatcaaggggatggggacaggaagctaacagccgaggaggag
gaggctcggaggatagcagagatgggcaagccagttcttggggagaactgccggctggag
gtcatcatcgaggagtcatatgattttaagaacacggtggataaactcatcaagaaaacg
aacttggccttggtaattgggacccattcatggagggagcagtttttagaggcaattacg
gtgagcgcaggggacgaggaggaggaggaggacgggtcccgggaggagcggctgccgtcg
tgctttgactacgtgatgcacttcctgacggtgttctggaaggtgctcttcgcctgtgtg
ccccccaccgagtactgccacggctgggcctgctttggtgtctccatcctggtcatcggc
ctgctcaccgccctcattggggacctcgcctcccacttcggctgcaccgttggcctcaag
gactctgtcaatgctgttgtcttcgttgccctgggcacctccatccctgacacgttcgcc
agcaaggtggcggcgctgcaggaccagtgcgccgacgcgtccatcggcaacgtgaccggc
tccaacgcggtgaacgtgttccttggcctgggcgtcgcctggtctgtggccgccgtgtac
tgggcggtgcagggccgccccttcgaggtgcgcactggcacgctggccttctccgtcacg
ctcttcaccgtcttcgccttcgtgggcattgccgtgctgctgtaccggcgccggccgcac
atcggcggcgagctgggcggcccgcgcggacccaagctcgccaccaccgcgctcttcctg
ggcctctggctcctgtacatcctcttcgccagcctggaggcgtactgccacatccggggc
ttctag

KEGG   Homo sapiens (human): 6546Help
Entry
6546              CDS       T01001                                 

Gene name
SLC8A1, NCX1
Definition
(RefSeq) solute carrier family 8 member A1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04740  Olfactory transduction
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04974  Protein digestion and absorption
hsa04978  Mineral absorption
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6546 (SLC8A1)
   04020 Calcium signaling pathway
    6546 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    6546 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    6546 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    6546 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    6546 (SLC8A1)
   04978 Mineral absorption
    6546 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    6546 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    6546 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    6546 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6546 (SLC8A1)
   05414 Dilated cardiomyopathy (DCM)
    6546 (SLC8A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   6546 (SLC8A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Others
   6546 (SLC8A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C DnaG_DnaB_bind
Motif
Other DBs
NCBI-GeneID: 6546
NCBI-ProteinID: NP_066920
OMIM: 182305
HGNC: 11068
Ensembl: ENSG00000183023
Vega: OTTHUMG00000102183
Pharos: P32418(Tbio)
UniProt: P32418
LinkDB All DBs
Position
2p22.1
AA seq 973 aa AA seqDB search
MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGII
DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
EIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPV
FRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESY
EFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHF
LTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQF
KVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIF
FSSLEAYCHIKGF
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatgcggcgattaagtctttcacccaccttttcaatgggatttcatctgtta
gttactgtgagtctcttattttcccatgtggaccatgtaattgctgagacagaaatggaa
ggagaaggaaatgaaactggtgaatgtactggatcatattactgtaagaaaggggtgatt
ttgcccatttgggaaccccaagacccttcttttggggacaaaattgctagagctactgtg
tattttgtggccatggtctacatgtttcttggagtctctatcatagctgatcggttcatg
tcctctatagaagtcatcacatctcaagaaaaagaaataaccataaagaaacccaatgga
gagaccaccaagacaactgtgaggatctggaatgaaacagtttctaacctgaccttgatg
gccctgggatcttctgctcctgagattctcctttcagtaattgaagtgtgtggccataac
ttcactgcaggagacctcggtcctagcaccatcgtgggaagtgctgcattcaatatgttc
atcattattgcactctgtgtttatgtggtgcctgacggagagacaaggaagattaagcat
ttgcgtgtcttctttgtgacagcagcctggagcatctttgcctacacctggctttacatt
attttgtctgtcatatctcctggtgttgtggaggtctgggaaggtttgcttactttcttc
ttctttcccatctgtgttgtgttcgcttgggtagcggataggagacttctgttttacaag
tatgtctacaagaggtatcgagctggcaagcagagggggatgattattgaacatgaagga
gacaggccatcttctaagactgaaattgaaatggacgggaaagtggtcaattctcatgtt
gaaaatttcttagatggtgctctggttctggaggtggatgagagggaccaagatgatgaa
gaagctaggcgagaaatggctaggattctgaaggaacttaagcagaagcatccagataaa
gaaatagagcaattaatagaattagctaactaccaagtcctaagtcagcagcaaaaaagt
agagcattttatcgcattcaagctactcgcctcatgactggagctggcaacattttaaag
aggcatgcagctgaccaagcaaggaaggctgtcagcatgcacgaggtcaacactgaagtg
actgaaaatgaccctgttagtaagatcttctttgaacaagggacatatcagtgtctggag
aactgtggtactgtggcccttaccattatccgcagaggtggtgatttgactaacactgtg
tttgttgacttcagaacagaggatggcacagcaaatgctgggtctgattatgaatttact
gaaggaactgtggtgtttaagcctggtgatacccagaaggaaatcagagtgggtatcata
gatgatgatatctttgaggaggatgaaaatttccttgtgcatctcagcaatgtcaaagta
tcttctgaagcttcagaagatggcatactggaagccaatcatgtttctacacttgcttgc
ctcggatctccctccactgccactgtaactatttttgatgatgaccacgcaggcattttt
acttttgaggaacctgtgactcatgtgagtgagagcattggcatcatggaggtgaaagta
ttgagaacatctggagctcgaggaaatgttatcgttccatataaaaccatcgaagggact
gccagaggtggaggggaggattttgaggacacttgtggagagctcgaattccagaatgat
gaaattgtcaaaacaatatcagtcaaggtaattgatgatgaggagtatgagaaaaacaag
accttcttccttgagattggagagccccgcctggtggagatgagtgagaagaaagccctg
ttattgaatgagcttggtggcttcacaataacaggaaaatacctgtttggccaacctgtc
ttcaggaaggttcatgctagagaacatccgattctctctactgtaatcaccattgcagac
gaatatgatgacaagcagccactgaccagcaaagaggaagaggagaggcgcattgcagaa
atggggcgccccatcctgggagagcacaccaagttggaagtgatcattgaagaatcctat
gaattcaagagtactgtggacaaactcattaagaagacaaacctggcccttgtggttggg
actaacagctggagagaacagttcattgaagctatcactgtcagtgctggggaagatgat
gacgacgatgaatgtggggaagagaagctgccctcctgtttcgattacgtgatgcacttt
ctgactgtgttctggaaggtcctgtttgccttcgtcccccctactgaatactggaatggc
tgggcgtgtttcattgtctccatcctcatgattggcctactgacagctttcattggagac
ctggcttcccactttggctgcaccattggcctgaaagattctgtgactgcagtcgtgttc
gtcgcacttggaacatcagtgccagacacatttgccagcaaagtggcagccacccaggac
cagtatgcagacgcctccataggtaacgtcacgggcagcaacgcggtgaatgtcttcctg
ggaatcggtgtggcctggtccatcgctgccatctaccacgcagccaatggggaacagttc
aaagtgtcccctggcacactagctttctctgtcactctcttcaccatttttgctttcatc
aatgtgggggtgctgctgtatcggcggaggccagaaatcggaggtgagctgggtgggccc
cggactgccaagctcctcacatcctgcctctttgtgctcctatggctcttgtacattttc
ttctcctccctggaggcctactgccacataaaaggcttctaa

KEGG   Homo sapiens (human): 6547Help
Entry
6547              CDS       T01001                                 

Gene name
SLC8A3, NCX3
Definition
(RefSeq) solute carrier family 8 member A3
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04740  Olfactory transduction
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04974  Protein digestion and absorption
hsa04978  Mineral absorption
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6547 (SLC8A3)
   04020 Calcium signaling pathway
    6547 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    6547 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    6547 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    6547 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    6547 (SLC8A3)
   04978 Mineral absorption
    6547 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    6547 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    6547 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    6547 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6547 (SLC8A3)
   05414 Dilated cardiomyopathy (DCM)
    6547 (SLC8A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   6547 (SLC8A3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Others
   6547 (SLC8A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Motif
Other DBs
NCBI-GeneID: 6547
NCBI-ProteinID: NP_892114
OMIM: 607991
HGNC: 11070
Ensembl: ENSG00000100678
Vega: OTTHUMG00000152342
Pharos: P57103(Tbio)
UniProt: P57103
LinkDB All DBs
Position
14q24.2
AA seq 927 aa AA seqDB search
MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISALLLSPDVTDRKLTMEEEEAKRIAEMGKPVL
GEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFG
CTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLA
TTWLFVSLWLLYILFATLEAYCYIKGF
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggttaaggttgcagcctctcacctctgccttcctccattttgggctggttacc
tttgtgctcttcctgaatggtcttcgagcagaggctggtggctcaggggacgtgccaagc
acagggcagaacaatgagtcctgttcagggtcatcggactgcaaggagggtgtcatcctg
ccaatctggtacccggagaacccttcccttggggacaagattgccagggtcattgtctat
tttgtggccctgatatacatgttccttggggtgtccatcattgctgaccgcttcatggca
tctattgaagtcatcacctctcaagagagggaggtgacaattaagaaacccaatggagaa
accagcacaaccactattcgggtctggaatgaaactgtctccaacctgacccttatggcc
ctgggttcctctgctcctgagatactcctctctttaattgaggtgtgtggtcatgggttc
attgctggtgatctgggaccttctaccattgtagggagtgcagccttcaacatgttcatc
atcattggcatctgtgtctacgtgatcccagacggagagactcgcaagatcaagcatcta
cgagtcttcttcatcaccgctgcttggagtatctttgcctacatctggctctatatgatt
ctggcagtcttctcccctggtgtggtccaggtttgggaaggcctcctcactctcttcttc
tttccagtgtgtgtccttctggcctgggtggcagataaacgactgctcttctacaaatac
atgcacaaaaagtaccgcacagacaaacaccgaggaattatcatagagacagagggtgac
caccctaagggcattgagatggatgggaaaatgatgaattcccattttctagatgggaac
ctggtgcccctggaagggaaggaagtggatgagtcccgcagagagatgatccggattctc
aaggatctgaagcaaaaacacccagagaaggacttagatcagctggtggagatggccaat
tactatgctctttcccaccaacagaagagccgtgccttctaccgtatccaagccactcgt
atgatgactggtgcaggcaatatcctgaagaaacatgcagcagaacaagccaagaaggcc
tccagcatgagcgaggtgcacaccgatgagcctgaggactttatttccaaggtcttcttt
gacccatgttcttaccagtgcctggagaactgtggggctgtactcctgacagtggtgagg
aaagggggagacatgtcaaagaccatgtatgtggactacaaaacagaggatggttctgcc
aatgcaggggctgactatgagttcacagagggcacggtggttctgaagccaggagagacc
cagaaggagttctccgtgggcataattgatgacgacatttttgaggaggatgaacacttc
tttgtaaggttgagcaatgtccgcatagaggaggagcagccagaggaggggatgcctcca
gcaatattcaacagtcttcccttgcctcgggctgtcctagcctccccttgtgtggccaca
gttaccatcttggatgatgaccatgcaggcatcttcacttttgaatgtgatactattcat
gtcagtgagagtattggtgttatggaggtcaaggttctgcggacatcaggtgcccggggt
acagtcatcgtcccctttaggacagtagaagggacagccaagggtggcggtgaggacttt
gaagacacatatggggagttggaattcaagaatgatgaaactgtgaaaaccataagggtt
aaaatagtagatgaggaggaatacgaaaggcaagagaatttcttcattgcccttggtgaa
ccgaaatggatggaacgtggaatatcagcgctcctgttatctccagatgtgacagacagg
aagctgactatggaagaagaggaggccaagaggatagcagagatgggaaagccagtattg
ggtgaacaccccaaactagaagtcatcattgaagagtcctatgagttcaagactacggtg
gacaaactgatcaagaagacaaacctggccttggttgtggggacccattcctggagggac
cagttcatggaggccatcaccgtcagtgcagcaggggatgaggatgaggatgaatccggg
gaggagaggctgccctcctgctttgactacgtcatgcacttcctgactgtcttctggaag
gtgctgtttgcctgtgtgccccccacagagtactgccacggctgggcctgcttcgccgtc
tccatcctcatcattggcatgctcaccgccatcattggggacctggcctcgcacttcggc
tgcaccattggtctcaaagattcagtcacagctgttgttttcgtggcatttggcacctct
gtcccagatacgtttgccagcaaagctgctgccctccaggatgtatatgcagacgcctcc
attggcaacgtgacgggcagcaacgccgtcaatgtcttcctgggcatcggcctggcctgg
tccgtggccgccatctactgggctctgcagggacaggagttccacgtgtcggccggcaca
ctggccttctccgtcaccctcttcaccatctttgcatttgtctgcatcagcgtgctcttg
taccgaaggcggccgcacctgggaggggagcttggtggcccccgtggctgcaagctcgcc
acaacatggctctttgtgagcctgtggctcctctacatactctttgccacactagaggcc
tattgctacatcaaggggttctaa

DBGET integrated database retrieval system