KEGG   Homo sapiens (human): 6573
Entry
6573              CDS       T01001                                 

Gene name
SLC19A1, CHMD, FOLT, IFC-1, IFC1, REFC, RFC, RFC1, RFT-1, hRFC, hSLC19A1
Definition
(RefSeq) solute carrier family 19 member 1
  KO
K14609  solute carrier family 19 (folate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    6573 (SLC19A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    6573 (SLC19A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6573 (SLC19A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC19: Folate/thiamine transporter
   6573 (SLC19A1)
SSDB
Motif
Pfam: Folate_carrier
Other DBs
NCBI-GeneID: 6573
NCBI-ProteinID: NP_919231
OMIM: 600424
HGNC: 10937
Ensembl: ENSG00000173638
Vega: OTTHUMG00000090397
Pharos: P41440(Tchem)
UniProt: P41440
LinkDB
Position
21q22.3
AA seq 591 aa
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKA
AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPV
TTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggtgccctccagcccagcggtggagaagcaggtgcccgtggaacctgggcctgacccc
gagctccggtcctggcggcacctcgtgtgctacctttgcttctacggcttcatggcgcag
atacggccaggggagagcttcatcaccccctacctcctggggcccgacaagaacttcacg
cgggagcaggtcacgaacgagatcacgccggtgctgtcgtactcctacctggccgtgctg
gtgcccgtgttcctgctcaccgactacctgcgctacacgccggtgctgctgctgcagggg
ctcagcttcgtgtcggtgtggctgctgctgctgctgggccactcggtggcgcacatgcag
ctcatggagctcttctacagcgtcaccatggccgcgcgcatcgcctattcctcctacatc
ttctctctcgtgcggcccgcgcgctaccagcgtgtggccggctactcgcgcgctgcggtg
ctgctgggcgtgttcaccagctccgtgctgggccagctgctggtcactgtgggccgagtc
tccttctccacgctcaactacatctcgctggccttcctcaccttcagcgtggtcctcgcc
ctcttcctgaagcgccccaagcgcagcctcttcttcaaccgcgacgaccgggggcggtgc
gaaacctcggcttcggagctggagcgcatgaatcctggcccaggcgggaagctgggacac
gccctgcgggtggcctgtggggactcagtgctggcgcggatgctgcgggagctgggggac
agcctgcggcggccgcagctgcgcctgtggtccctctggtgggtcttcaactcggccggc
tactacctggtggtctactacgtgcacatcctgtggaacgaggtggaccccaccaccaac
agtgcgcgggtctacaacggcgcggcagatgctgcctccacgctgctgggcgccatcacg
tccttcgccgcgggcttcgtgaagatccgctgggcgcgctggtccaagctgctcatcgcg
ggcgtcacggccacgcaggcggggctggtcttccttctggcgcacacgcgccacccgagc
agcatctggctgtgctatgcggccttcgtgctgttccgcggctcctaccagttcctcgtg
cccatcgccacctttcagattgcatcttctctgtctaaagagctctgtgccctggtcttc
ggggtcaacacgttctttgccaccatcgtcaagaccatcatcactttcattgtctcggac
gtgcggggcctgggcctcccggtccgcaagcagttccagttatactccgtgtacttcctg
atcctgtccatcatctacttcttgggggccatgctggatggcctgcggcactgccagcgg
ggccaccacccgcggcagcccccggcccagggcctgaggagtgccgcggaggagaaggca
gcacaggcactgagcgtgcaggacaagggcctcggaggcctgcagccagcccagagcccg
ccgctttccccagaagacagcctgggggctgtggggccagcctccctggagcagagacag
agcgacccatacctggcccaggccccggccccgcaggcagctgaattcctgagcccagtg
acaaccccttccccctgcactctgtgctccgcccaagcctcaggccctgaggctgcagat
gagacttgtccccagctggctgtccatcctcctggtgtcagcaagctgggtttgcagtgt
cttccaagcgacggtgttcagaatgtgaaccagtga

DBGET integrated database retrieval system