KEGG   Homo sapiens (human): 6579
Entry
6579              CDS       T01001                                 

Gene name
SLCO1A2, OATP, OATP-A, OATP1A2, SLC21A3
Definition
(RefSeq) solute carrier organic anion transporter family member 1A2
  KO
K03460  solute carrier organic anion transporter family, member 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    6579 (SLCO1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6579 (SLCO1A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   6579 (SLCO1A2)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 ASFV_L11L
Other DBs
NCBI-GeneID: 6579
NCBI-ProteinID: NP_066580
OMIM: 602883
HGNC: 10956
Ensembl: ENSG00000084453
Vega: OTTHUMG00000156259
Pharos: P46721(Tbio)
UniProt: P46721 A0A024RAT5
LinkDB
Position
12p12.1
AA seq 670 aa
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggagaaactgagaaaagaattgaaacccatagaataagatgtctttccaagttgaag
atgtttctgttggcaataacatgtgcatttgtatccaaaacactgtctggatcttatatg
aattccatgctcacacaaatagagagacaattcaacatcccaacatctctagttggattc
attaatggaagctttgagattggaaatcttttgttgattatatttgtgagttattttgga
accaaactgcatagacctataatgattggcattggatgtgtggttatgggcttaggctgt
ttcttaaaatcactacctcatttcctcatgaaccaatatgaatatgaatctacagtttca
gtttcaggcaacttgtcctcaaacagtttcttgtgtatggaaaatggaacccagatttta
agaccaacgcaggatccatcagagtgtacaaaggaagttaaatcattaatgtgggtgtac
gtcctagtaggcaatattgtacgtggaatgggtgaaactcccatcctgcctttgggtatt
tcctatatagaagattttgccaaatttgaaaattctcctttatatattgggcttgtagaa
acaggagctattattggtcctttgattggacttttgttggcatcattctgtgcaaatgtt
tatgttgacactggatttgtgaacacagatgatctgatcataactcccactgacactcgt
tgggtcggtgcatggtggtttggctttctgatttgtgcaggagttaacgtgctcactgcc
attccttttttctttttgcccaacacacttccaaaggaaggactagagactaatgctgac
atcattaaaaatgaaaatgaagacaaacaaaaagaagaggtcaagaaggaaaaatatgga
atcactaaagattttctacctttcatgaaaagtctttcctgcaatccaatttatatgctt
ttcatacttgtaagtgtgatacagttcaatgcattcgttaacatgatctccttcatgcct
aaatacctagaacagcaatatggaatatcatcttcagatgcaatctttctaatgggtatt
tataacttacctccaatatgtattggatatataattggtggtttaattatgaagaagttc
aagattactgtcaaacaagctgcccacataggatgttggttatccttacttgagtatctt
ctctattttttatcttttctcatgacttgtgaaaattcttcagttgttggaataaatacc
tcttatgaaggaattccacaagatttatatgtggaaaatgacatctttgctgattgcaat
gtggattgcaactgtccatctaaaatatgggatcctgtgtgtggaaacaatggcttgtca
tatctgtcagcttgtcttgctggttgtgagacatccattggaacgggaataaacatggtg
ttccaaaattgcagctgtattcaaacatcaggaaattcatctgcagttcttgggctgtgc
gacaaaggacctgactgttccttgatgctccagtacttcctaatcttgtcagcgatgagc
agtttcatttattctttggctgccatacctggatatatggttctcttgaggtgtatgaaa
tctgaagagaagtcccttggtgtgggattacatacattttgcacaagagtatttgctggc
attcctgcacctatatattttggcgctttaatggattccacatgtttacactggggaact
ttgaaatgtggtgagtcaggggcatgcaggatatatgattccaccaccttcagatacatc
tacctcggattgccggcagcactaagaggatcaagctttgttccagccttaatcatctta
attcttttgaggaagtgtcatctacctggtgaaaatgcctcttcaggaacagagcttata
gagacaaaagtcaaagggaaggaaaatgagtgcaaagatatataccaaaagtccacggtt
ttgaaagatgatgaattgaaaactaaattgtaa

DBGET integrated database retrieval system