KEGG   Homo sapiens (human): 65975Help
Entry
65975             CDS       T01001                                 

Gene name
STK33
Definition
(RefSeq) serine/threonine kinase 33
  KO
K08813  serine/threonine kinase 33 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    65975 (STK33)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65975 (STK33)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  Other
   65975 (STK33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo Kinase-like RIO1 YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 65975
NCBI-ProteinID: NP_001275990
OMIM: 607670
HGNC: 14568
Ensembl: ENSG00000130413
Vega: OTTHUMG00000140275
Pharos: Q9BYT3(Tchem)
UniProt: Q9BYT3
LinkDB All DBs
Position
11p15.4
AA seq 514 aa AA seqDB search
MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERK
KEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGR
ILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQ
VFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLK
LENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDY
SQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSISDCAKSVLKQ
LMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAE
IKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagtggcttagataaaaaatccacaaaatgccccgactgttcatctgcttct
cagaaagatgtactttgtgtatgttccagcaaaacaagggttcctccagttttggtggtg
gaaatgtcacagacatcaagcattggtagtgcagaatctttaatttcactggagagaaaa
aaagaaaaaaatatcaacagagatataacctccaggaaagatttgccctcaagaacctca
aatgtagagagaaaagcatctcagcaacaatggggtcggggcaactttacagaaggaaaa
gttcctcacataaggattgagaatggagctgctattgaggaaatctatacctttggaaga
atattgggaaaagggagctttggaatagtcattgaagcgacagacaaggaaacagaaacg
aagtgggcaattaaaaaagtgaacaaagaaaaggctggaagctctgctgtgaagttactt
gaacgagaggtgaacattctgaaaagtgtaaaacatgaacacatcatacatctggaacaa
gtatttgaaacgccaaagaaaatgtaccttgtgatggagctttgtgaggatggagaactc
aaagaaattctggataggaaagggcatttctcagagaatgagacaaggtggatcattcaa
agtctcgcatcagctatagcatatcttcacaataatgatattgtacatagagatctgaaa
ctggaaaatataatggttaaaagcagtcttattgatgataacaatgaaataaacttaaac
ataaaggtgactgattttggcttagcggtgaagaagcaaagtaggagtgaagccatgctg
caggccacatgtgggactcctatctatatggcccctgaagttatcagtgcccacgactat
agccagcagtgtgacatttggagcataggcgtcgtaatgtacatgttattacgtggagaa
ccaccctttttggcaagctcagaagagaagctttttgagttaataagaaaaggagaacta
cattttgaaaatgcagtctggaattccataagtgactgtgctaaaagtgttttgaaacaa
cttatgaaagtagatcctgctcacagaatcacagctaaggaactactagataaccagtgg
ttaacaggcaataaactttcttcggtgagaccaaccaatgtattagagatgatgaaggaa
tggaaaaataacccagaaagtgttgaggaaaacacaacagaagagaagaataagccgtcc
actgaagaaaagttgaaaagttaccaaccctggggaaatgtccctgatgccaattacact
tcagatgaagaggaggaaaaacagtctactgcttatgaaaagcaatttcctgcaaccagt
aaggacaactttgatatgtgcagttcaagtttcacatctagcaaactccttccagctgaa
atcaagggagaaatggagaaaacccctgtgactccaagccaaggaacagcaaccaagtac
cctgctaaatccggcgccctgtccagaaccaaaaagaaactctaa

DBGET integrated database retrieval system