KEGG   Homo sapiens (human): 664Help
Entry
664               CDS       T01001                                 

Gene name
BNIP3, NIP3
Definition
(RefSeq) BCL2 interacting protein 3
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    664 (BNIP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    664 (BNIP3)
   04137 Mitophagy - animal
    664 (BNIP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    664 (BNIP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    664 (BNIP3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    664 (BNIP3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Cargo receptors
    664 (BNIP3)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   664 (BNIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNIP3
Motif
Other DBs
NCBI-GeneID: 664
NCBI-ProteinID: NP_004043
OMIM: 603293
HGNC: 1084
Ensembl: ENSG00000176171
Vega: OTTHUMG00000019278
Pharos: Q12983(Tbio)
UniProt: Q12983 Q6NVY4
LinkDB All DBs
Structure
PDB: 

Position
10q26.3
AA seq 259 aa AA seqDB search
MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
AIGLGIYIGRRLTTSTSTF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgcggccgcagatccgcccggccccgccctgccctgtgagttcctccggccg
ggctgcggggctccgctcagtccgggagcgcagctgggccgcggcgctccgacctccgct
ttcccaccgcccgcagctgaagcacatcccgcagcccggcgcggactccgatcgccgcag
ttgccctctggcgccatgtcgcagaacggagcgcccgggatgcaggaggagagcctgcag
ggctcctgggtagaactgcacttcagcaataatgggaacgggggcagcgttccagcctcg
gtttctatttataatggagacatggaaaaaatactgctggacgcacagcatgagtctgga
cggagtagctccaagagctctcactgtgacagcccacctcgctcgcagacaccacaagat
accaacagagcttctgaaacagatacccatagcattggagagaaaaacagctcacagtct
gaggaagatgatattgaaagaaggaaagaagttgaaagcatcttgaagaaaaactcagat
tggatatgggattggtcaagtcggccggaaaatattccccccaaggagttcctctttaaa
cacccgaagcgcacggccaccctcagcatgaggaacacgagcgtcatgaagaaagggggc
atattctctgcagaatttctgaaagttttccttccatctctgctgctctctcatttgctg
gccatcggattggggatctatattggaaggcgtctgacaacctccaccagcaccttttga

DBGET integrated database retrieval system