KEGG   Homo sapiens (human): 6645
Entry
6645              CDS       T01001                                 

Gene name
SNTB2, D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Definition
(RefSeq) syntrophin beta 2
  KO
K24064  beta-syntrophin
Organism
hsa  Homo sapiens (human)
Network
  Element
N00465  Deleted DMD to dystrophin-associated protein complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6645 (SNTB2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   6645 (SNTB2)
SSDB
Motif
Pfam: PH_17 PDZ PH PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 6645
NCBI-ProteinID: NP_006741
OMIM: 600027
HGNC: 11169
Ensembl: ENSG00000168807
Vega: OTTHUMG00000137567
Pharos: Q13425(Tbio)
UniProt: Q13425 A0A024R732
LinkDB
Structure
PDB: 
2VRF

Position
16q22.1
AA seq 540 aa
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELE
PALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVK
QEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAV
QALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIM
ALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLY
DCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSIL
YRYPFERLKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgagggtagctgcggcgactgcggcggctggagcggggccggccatggcggtgtggacg
cgggccaccaaagcggggctggtggagctgctcctgagggagcgctgggtccgagtggtg
gccgagctgagcggggagagcctgagcctgacgggcgacgccgccgcggccgagctggag
cccgctctgggacccgcggccgccgccttcaacggcctcccaaacggcggcggcgcgggc
gactcgctgcccgggagcccaagccgcggcctggggcccccgagcccgccggcgccgcct
cggggccccgcgggtgaggcgggcgcgtcgccgcccgtgcgccgggtgcgggtggtgaag
caagaggcgggcggcctgggcatcagcatcaagggcggccgcgagaaccggatgccgatc
ctcatctccaagatcttccccgggctggctgccgaccagagccgggcgctgcggctgggc
gacgccatcctgtcggtgaacggcaccgacctgcgccaggccacccacgaccaggccgtg
caggcgctgaagcgcgcgggcaaggaggtgctgctggaggtcaagttcatccgagaagta
acaccatatatcaagaagccatcattagtatcagatctgccgtgggaaggtgcagccccc
cagtcaccaagctttagtggcagtgaggactctggttcgccaaaacaccagaacagcacc
aaggacaggaagatcatccctctcaaaatgtgctttgctgctagaaacctaagcatgccg
gatctggaaaacagattgatagagctacattctcctgatagcaggaacacgttgatccta
cgctgcaaagatacagccacagcacactcctggttcgtagctatccacaccaacataatg
gctctcctcccacaggtgttggctgaactcaacgccatgcttggggcaaccagtacagca
ggaggcagtaaagaggtgaagcatattgcctggctggcagaacaggcaaaactagatggt
ggaagacagcaatggagacctgtcctcatggctgtgactgagaaggatttgctgctctat
gactgtatgccgtggacaagagatgcctgggcgtcaccatgccacagctacccacttgtt
gccaccaggttggttcattctggctccggatgtcgatccccctcccttggatctgacctt
acatttgctaccaggacaggctctcgacagggcattgagatgcatctcttcagggtggag
acacatcgggatctgtcatcctggaccaggatacttgttcagggttgccatgctgctgct
gagctgatcaaggaagtctctctaggctgcatgttaaatggccaagaggtgaggcttact
attcactatgaaaatgggttcaccatctcaagggaaaatggaggctccagcagcatattg
taccgctacccctttgaaaggctgaagatgtctgctgatgatggcatccgaaatctatac
ttggattttggtggtcccgagggagaactgaccatggacctgcactcttgtccgaagccg
attgtatttgtgttgcacacgtttttatcggccaaagtcactcgtatgggactgcttgta
tga

DBGET integrated database retrieval system