KEGG   Homo sapiens (human): 6672Help
Entry
6672              CDS       T01001                                 

Gene name
SP100, lysp100b
Definition
(RefSeq) SP100 nuclear antigen
  KO
K15413  nuclear autoantigen Sp-100
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    6672 (SP100)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6672 (SP100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSR SAND HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 6672
NCBI-ProteinID: NP_003104
OMIM: 604585
HGNC: 11206
Ensembl: ENSG00000067066
Vega: OTTHUMG00000133203
Pharos: P23497(Tbio)
UniProt: P23497
LinkDB All DBs
Structure
PDB: 

Position
2q37.1
AA seq 879 aa AA seqDB search
MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRN
KVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLP
VLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENS
FRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQ
KAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK
PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPL
ESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQP
QEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHR
SKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINF
KQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIR
CGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCS
ETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFC
SEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgggggcggcgacctgagcaccaggaggctgaatgaatgtatttcaccagta
gcaaatgagatgaaccatcttcctgcacacagccacgatttgcaaaggatgttcacggaa
gaccagggtgtagatgacaggctgctctatgacattgtattcaagcacttcaaaagaaat
aaggtggagatttcaaatgcaataaaaaagacatttccattcctcgagggcctccgtgat
cgtgatctcatcacaaataaaatgtttgaagattctcaagattcttgtagaaacctggtc
cctgtacagagagtggtgtacaatgttcttagtgaactggagaagacatttaacctgcca
gttctggaagcactgttcagcgatgtcaacatgcaggaataccccgatttaattcacatt
tataaaggctttgaaaatgtaatccatgacaaattgcctctccaagaaagtgaagaagaa
gagagggaggagaggtctggcctccaactaagtcttgaacaaggaactggtgaaaactct
tttcgaagcctgacttggccaccttcgggttccccatctcatgctggtacaaccccacct
gaaaatggactctcagagcacccctgtgaaacagaacagataaatgcaaagagaaaagat
acaaccagtgacaaagatgattcgctaggaagccaacaaacaaatgaacaatgtgctcaa
aaggctgagccaacagagtcctgcgaacaaattgctgtccaagtgaataatggggatgct
ggaagggagatgccctgcccgttgccctgtgatgaagaaagcccagaggcagagctacac
aaccatggaatccaaattaattcctgttctgtgcgactggtggatataaaaaaggaaaag
ccattttctaattcaaaagttgagtgccaagcccaagcaagaactcatcataaccaggca
tctgacataatagtcatcagcagtgaggactctgaaggatccactgacgttgatgagccc
ttagaagtcttcatctcagcaccgagaagtgagcctgtgatcaataatgacaacccttta
gaatcaaatgatgaaaaggagggccaagaagccacttgctcacgaccccagattgtacca
gagcccatggatttcagaaaattatctacattcagagaaagttttaagaaaagagtgata
ggacaagaccacgacttttcagaatccagtgaggaggaggcgcccgcagaagcctcgagc
ggggcactgagaagcaagcatggtgagaaggctcctatgacttctagaagtacatctact
tggagaatacccagcaggaagagacgtttcagcagtagtgacttttcagacctgagtaat
ggagaagagcttcaggaaacctgcagctcatccctaagaagagggtcaggatcacagcca
caagaacctgaaaataagaagtgctcctgtgtcatgtgttttccaaaaggtgtgccaaga
agccaagaagcaaggactgaaagtagtcaagcatctgacatgatggataccatggatgtt
gaaaacaattctactttggaaaaacacagtgggaaaagaagaaaaaagagaaggcataga
tctaaagtaaatggtctccaaagagggagaaagaaagacagacctagaaaacatttaact
ctgaataacaaagtccaaaagaaaagatggcaacaaagaggaagaaaagccaacactaga
cctttgaaaagaagaagaaaaagaggtccaagaattcccaaagatgaaaatattaatttt
aaacaatctgaacttcctgtgacctgtggtgaggtgaagggcactctatataaggagcga
ttcaaacaaggaacctcaaagaagtgtatacagagtgaggataaaaagtggttcactccc
agggaatttgaaattgaaggagaccgcggagcatccaagaactggaagctaagtatacgc
tgcggtggatataccctgaaagtcctgatggagaacaaatttctgccagaaccaccaagc
acaagaaaaaagagaatactggaatctcacaacaataccttagttgacccttgtgaggag
cataagaagaagaacccagatgcttcagtcaagttctcagagtttttaaagaagtgctca
gagacatggaagaccatttttgctaaagagaaaggaaaatttgaagatatggcaaaggcg
gacaaggcccattatgaaagagaaatgaaaacctatatccctcctaaaggggagaaaaaa
aagaagttcaaggatcccaatgcacccaagaggcctcctttggcctttttcctgttctgc
tctgagtatcgcccaaaaatcaaaggagaacatcctggcctgtccattgatgatgttgtg
aagaaactggcagggatgtggaataacaccgctgcagctgacaagcagttttatgaaaag
aaggctgcaaagctgaaggaaaaatacaaaaaggatattgctgcatatcgagctaaagga
aagcctaattcagcaaaaaagagagttgtcaaggctgaaaaaagcaagaaaaagaaggaa
gaggaagaagatgaagaggatgaacaagaggaggaaaatgaagaagatgatgataaataa

DBGET integrated database retrieval system