KEGG   Homo sapiens (human): 6688Help
Entry
6688              CDS       T01001                                 

Gene name
SPI1, OF, PU.1, SFPI1, SPI-1, SPI-A
Definition
(RefSeq) Spi-1 proto-oncogene
  KO
K09438  transcription factor PU.1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Disease
H00003  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    6688 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6688 (SPI1)
   05202 Transcriptional misregulation in cancer
    6688 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    6688 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6688 (SPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6688 (SPI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    6688 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 6688
NCBI-ProteinID: NP_003111
OMIM: 165170
HGNC: 11241
Ensembl: ENSG00000066336
Vega: OTTHUMG00000150150
Pharos: P17947(Tbio)
UniProt: P17947
LinkDB All DBs
Position
11p11.2
AA seq 270 aa AA seqDB search
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccatcagaagacctg
gtgccctatgacacggatctataccaacgccaaacgcacgagtattacccctatctcagc
agtgatggggagagccatagcgaccattactgggacttccacccccaccacgtgcacagc
gagttcgagagcttcgccgagaacaacttcacggagctccagagcgtgcagcccccgcag
ctgcagcagctctaccgccacatggagctggagcagatgcacgtcctcgatacccccatg
gtgccaccccatcccagtcttggccaccaggtctcctacctgccccggatgtgcctccag
tacccatccctgtccccagcccagcccagctcagatgaggaggagggcgagcggcagagc
cccccactggaggtgtctgacggcgaggcggatggcctggagcccgggcctgggctcctg
cctggggagacaggcagcaagaagaagatccgcctgtaccagttcctgttggacctgctc
cgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttccag
ttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaaccgc
aagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggcgag
gtcaagaaggtgaagaagaagctcacctaccagttcagcggcgaagtgctgggccgcggg
ggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system