KEGG   Homo sapiens (human): 6692Help
Entry
6692              CDS       T01001                                 

Gene name
SPINT1, HAI, HAI1, MANSC2
Definition
(RefSeq) serine peptidase inhibitor, Kunitz type 1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00129  TMPRSS2-ERG fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6692 (SPINT1)
  09162 Cancer: specific types
   05215 Prostate cancer
    6692 (SPINT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a Chordopox_A13L Antimicrobial12
Motif
Other DBs
NCBI-GeneID: 6692
NCBI-ProteinID: NP_857593
OMIM: 605123
HGNC: 11246
Ensembl: ENSG00000166145
Vega: OTTHUMG00000130068
Pharos: O43278(Tbio)
UniProt: O43278
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 529 aa AA seqDB search
MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPG
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVV
AILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgcgaggacgatggcccgcgcccgcctcgccccggccggcatccctgccgtc
gccttgtggcttctgtgcacgctcggcctccagggcacccaggccgggccaccgcccgcg
ccccctgggctgcccgcgggagccgactgcctgaacagctttaccgccggggtgcctggc
ttcgtgctggacaccaacgcctcggtcagcaacggagctaccttcctggagtcccccacc
gtgcgccggggctgggactgcgtgcgcgcctgctgcaccacccagaactgcaacttggcg
ctagtggagctgcagcccgaccgcggggaggacgccatcgccgcctgcttcctcatcaac
tgcctctacgagcagaacttcgtgtgcaagttcgcgcccagggagggcttcatcaactac
ctcacgagggaagtgtaccgctcctaccgccagctgcggacccagggctttggagggtct
gggatccccaaggcctgggcaggcatagacttgaaggtacaaccccaggaacccctggtg
ctgaaggatgtggaaaacacagattggcgcctactgcggggtgacacggatgtcagggta
gagaggaaagacccaaaccaggtggaactgtggggactcaaggaaggcacctacctgttc
cagctgacagtgactagctcagaccacccagaggacacggccaacgtcacagtcactgtg
ctgtccaccaagcagacagaagactactgcctcgcatccaacaaggtgggtcgctgccgg
ggctctttcccacgctggtactatgaccccacggagcagatctgcaagagtttcgtttat
ggaggctgcttgggcaacaagaacaactaccttcgggaagaagagtgcattctagcctgt
cggggtgtgcaaggtgggcctttgagaggcagctctggggctcaggcgactttcccccag
ggcccctccatggaaaggcgccatccagtgtgctctggcacctgtcagcccacccagttc
cgctgcagcaatggctgctgcatcgacagtttcctggagtgtgacgacacccccaactgc
cccgacgcctccgacgaggctgcctgtgaaaaatacacgagtggctttgacgagctccag
cgcatccatttccccagtgacaaagggcactgcgtggacctgccagacacaggactctgc
aaggagagcatcccgcgctggtactacaaccccttcagcgaacactgcgcccgctttacc
tatggtggttgttacggcaacaagaacaactttgaggaagagcagcagtgcctcgagtct
tgtcgcggcatctccaagaaggatgtgtttggcctgaggcgggaaatccccattcccagc
acaggctctgtggagatggctgtcgcagtgttcctggtcatctgcattgtggtggtggta
gccatcttgggttactgcttcttcaagaaccagagaaaggacttccacggacaccaccac
cacccaccacccacccctgccagctccactgtctccactaccgaggacacggagcacctg
gtctataaccacaccacgcggcccctctga

DBGET integrated database retrieval system