KEGG   Homo sapiens (human): 6718
Entry
6718              CDS       T01001                                 

Gene name
AKR1D1, 3o5bred, CBAS2, SRD5B1
Definition
(RefSeq) aldo-keto reductase family 1 member D1
  KO
K00251  3-oxo-5-beta-steroid 4-dehydrogenase [EC:1.3.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
N00809  AKR1D1 deficiency in bile acid biosynthesis
Disease
H00628  Congenital bile acid synthesis defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    6718 (AKR1D1)
   00140 Steroid hormone biosynthesis
    6718 (AKR1D1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.3  Delta4-3-oxosteroid 5beta-reductase
     6718 (AKR1D1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 6718
NCBI-ProteinID: NP_005980
OMIM: 604741
HGNC: 388
Ensembl: ENSG00000122787
Vega: OTTHUMG00000155787
Pharos: P51857(Tbio)
UniProt: P51857
LinkDB
Structure
PDB: 

Position
7q33
AA seq 326 aa
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQN
EHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIE
VPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL
NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLK
DALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE
ALNKNVRFVELLMWRDHPEYPFHDEY
NT seq 981 nt   +upstreamnt  +downstreamnt
atggatctcagtgctgcaagtcaccgcatacctctaagtgatggaaacagcattcccatc
atcggacttggtacctactcagaacctaaatcgacccctaagggagcctgtgcaacatcg
gtgaaggttgctattgacacagggtaccgacatattgatggggcctacatctaccaaaat
gaacacgaagttggggaggccatcagggagaagatagcagaaggaaaggtgcggagggaa
gatatcttctactgtggaaagctatgggctacaaatcatgtcccagagatggtccgccca
accctggagaggacactcagggtcctccagctagattatgtggatctttacatcattgaa
gtacccatggcctttaagccaggagatgaaatataccctagagatgagaatggcaaatgg
ttatatcacaagtcaaatctgtgtgccacttgggaggcgatggaagcttgcaaagacgct
ggcttggtgaaatccctgggagtgtccaattttaaccgcaggcagctggagctcatcctg
aacaagccaggactcaaacacaagccagtcagcaaccaggttgagtgccatccgtatttc
acccagccaaaactcttgaaattttgccaacaacatgacattgtcattactgcatatagc
cctttggggaccagtaggaatccaatctgggtgaatgtttcttctccacctttgttaaag
gatgcacttctaaactcattggggaaaaggtacaataagacagcagctcaaattgttttg
cgtttcaacatccagcgaggggtggttgtcattcctaaaagctttaatcttgaaaggatc
aaagaaaattttcagatctttgacttttctctcactgaagaagaaatgaaggacattgaa
gccttgaataaaaatgtccgctttgtagaattgctcatgtggcgcgatcatcctgaatac
ccatttcatgatgaatactga

DBGET integrated database retrieval system