KEGG   Homo sapiens (human): 6732
Entry
6732              CDS       T01001                                 

Gene name
SRPK1, SFRSK1
Definition
(RefSeq) SRSF protein kinase 1
  KO
K15409  serine/threonine-protein kinase SRPK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6732 (SRPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6732 (SRPK1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6732 (SRPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6732 (SRPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   6732 (SRPK1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    6732 (SRPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 6732
NCBI-ProteinID: NP_003128
OMIM: 601939
HGNC: 11305
Ensembl: ENSG00000096063
Vega: OTTHUMG00000014583
Pharos: Q96SB4(Tchem)
UniProt: Q96SB4
LinkDB
Structure
PDB: 

Position
6p21.31
AA seq 655 aa
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggagcggaaagtgcttgcgctccaggcccgaaagaaaaggaccaaggccaagaaggac
aaagcccaaaggaaatctgaaactcagcaccgaggctctgctccccactctgagagtgat
ctaccagagcaggaagaggagattctgggatctgatgatgatgagcaagaagatcctaat
gattattgtaaaggaggttatcatcttgtgaaaattggagatctattcaatgggagatac
catgtgatccgaaagttaggctggggacacttttcaacagtatggttatcatgggatatt
caggggaagaaatttgtggcaatgaaagtagttaaaagtgctgaacattacactgaaaca
gcactagatgaaatccggttgctgaagtcagttcgcaattcagaccctaatgatccaaat
agagaaatggttgttcaactactagatgactttaaaatatcaggagttaatggaacacat
atctgcatggtatttgaagttttggggcatcatctgctcaagtggatcatcaaatccaat
tatcaggggcttccactgccttgtgtcaaaaaaattattcagcaagtgttacagggtctt
gattatttacataccaagtgccgtatcatccacactgacattaaaccagagaacatctta
ttgtcagtgaatgagcagtacattcggaggctggctgcagaagcaacagaatggcagcga
tctggagctcctccgccttccggatctgcagtcagtactgctccccagcctaaaccagct
gacaaaatgtcaaagaataagaagaagaaattgaagaagaagcagaagcgccaggcagaa
ttactagagaagcgaatgcaggaaattgaggaaatggagaaagagtcgggccctgggcaa
aaaagaccaaacaagcaagaagaatcagagagtcctgttgaaagacccttgaaagagaac
ccacctaataaaatgacccaagaaaaacttgaagagtcaagtaccattggccaggatcaa
acgcttatggaacgtgatacagagggtggtgcagcagaaattaattgcaatggagtgatt
gaagtcattaattatactcagaacagtaataatgaaacattgagacataaagaggatcta
cataatgctaatgactgtgatgtccaaaatttgaatcaggaatctagtttcctaagctcc
caaaatggagacagcagcacatctcaagaaacagactcttgtacacctataacatctgag
gtgtcagacaccatggtgtgccagtcttcctcaactgtaggtcagtcattcagtgaacaa
cacattagccaacttcaagaaagcattcgggcagagataccctgtgaagatgaacaagag
caagaacataacggaccactggacaacaaaggaaaatccacggctggaaattttcttgtt
aatccccttgagccaaaaaatgcagaaaagctcaaggtgaagattgctgaccttggaaat
gcttgttgggtgcacaaacatttcactgaagatattcaaacaaggcaatatcgttccttg
gaagttctaatcggatctggctataatacccctgctgacatttggagcacggcatgcatg
gcctttgaactggccacaggtgactatttgtttgaacctcattcaggggaagagtacact
cgagatgaagatcacattgcattgatcatagaacttctggggaaggtgcctcgcaagctc
attgtggcaggaaaatattccaaggaatttttcaccaaaaaaggtgacctgaaacatatc
acgaagctgaaaccttggggcctttttgaggttctagtggagaagtatgagtggtcgcag
gaagaggcagctggcttcacagatttcttactgcccatgttggagctgatccctgagaag
agagccactgccgccgagtgtctccggcacccttggcttaactcctaa

DBGET integrated database retrieval system