KEGG   Homo sapiens (human): 6751
Entry
6751              CDS       T01001                                 

Gene name
SSTR1, SRIF-2, SS-1-R, SS1-R, SS1R
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  somatostatin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Drug target
Copper Cu 64 dotatate: D11882
Pasireotide (DG00503): D10147 D10497<US> D10566<JP/US>
Seglitide acetate: D05812
Somatostatin: D07431
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6751 (SSTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6751 (SSTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6751 (SSTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6751 (SSTR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6751 (SSTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 T2SSM Piezo_RRas_bdg
Other DBs
NCBI-GeneID: 6751
NCBI-ProteinID: NP_001040
OMIM: 182451
HGNC: 11330
Ensembl: ENSG00000139874
Vega: OTTHUMG00000140249
Pharos: P30872(Tclin)
UniProt: P30872 Q86SW9
LinkDB
Position
14q21.1
AA seq 391 aa
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctccttcctcctctcctagccccagcccgggcagc
tgcggcgaaggcggcggcagcaggggccccggggccggcgctgcggacggcatggaggag
ccagggcgaaatgcgtcccagaacgggaccttgagcgagggccagggcagcgccatcctg
atctctttcatctactccgtggtgtgcctggtggggctgtgtgggaactctatggtcatc
tacgtgatcctgcgctatgccaagatgaagacggccaccaacatctacatcctaaatctg
gccattgctgatgagctgctcatgctcagcgtgcccttcctagtcacctccacgttgttg
cgccactggcccttcggtgcgctgctctgccgcctcgtgctcagcgtggacgcggtcaac
atgttcaccagcatctactgtctgactgtgctcagcgtggaccgctacgtggccgtggtg
catcccatcaaggcggcccgctaccgccggcccaccgtggccaaggtagtaaacctgggc
gtgtgggtgctatcgctgctcgtcatcctgcccatcgtggtcttctctcgcaccgcggcc
aacagcgacggcacggtggcttgcaacatgctcatgccagagcccgctcaacgctggctg
gtgggcttcgtgttgtacacatttctcatgggcttcctgctgcccgtgggggctatctgc
ctgtgctacgtgctcatcattgctaagatgcgcatggtggccctcaaggccggctggcag
cagcgcaagcgctcggagcgcaagatcaccttaatggtgatgatggtggtgatggtgttt
gtcatctgctggatgcctttctacgtggtgcagctggtcaacgtgtttgctgagcaggac
gacgccacggtgagtcagctgtcggtcatcctcggctatgccaacagctgcgccaacccc
atcctctatggctttctctcagacaacttcaagcgctctttccaacgcatcctatgcctc
agctggatggacaacgccgcggaggagccggttgactattacgccaccgcgctcaagagc
cgtgcctacagtgtggaagacttccaacctgagaacctggagtccggcggcgtcttccgt
aatggcacctgcacgtcccggatcacgacgctctga

KEGG   Homo sapiens (human): 6752
Entry
6752              CDS       T01001                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor 2
  KO
K04218  somatostatin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
Drug target
Copper Cu 64 dotatate: D11882
Indium (111In) pentetreotide: D02108<JP/US>
Lanreotide: D04666<JP/US>
Lutetium (177Lu) oxodotreotide: D11033
Octreotide (DG00501): D00442 D02250<JP> D05230 D06495<US> D11204
Pasireotide (DG00503): D10147 D10497<US> D10566<JP/US>
Seglitide acetate: D05812
Somatostatin: D07431
Tidutamab: D11845
Vapreotide (DG00502): D06281 D09988
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6752 (SSTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6752 (SSTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6752 (SSTR2)
  09154 Digestive system
   04971 Gastric acid secretion
    6752 (SSTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6752 (SSTR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6752 (SSTR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Other DBs
NCBI-GeneID: 6752
NCBI-ProteinID: NP_001041
OMIM: 182452
HGNC: 11331
Ensembl: ENSG00000180616
Vega: OTTHUMG00000178343
Pharos: P30874(Tclin)
UniProt: P30874
LinkDB
Position
17q25.1
AA seq 369 aa
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacatggcggatgagccactcaatggaagccacacatggctatccattccatttgac
ctcaatggctctgtggtgtcaaccaacacctcaaaccagacagagccgtactatgacctg
acaagcaatgcagtcctcacattcatctattttgtggtctgcatcattgggttgtgtggc
aacacacttgtcatttatgtcatcctccgctatgccaagatgaagaccatcaccaacatt
tacatcctcaacctggccatcgcagatgagctcttcatgctgggtctgcctttcttggct
atgcaggtggctctggtccactggccctttggcaaggccatttgccgggtggtcatgact
gtggatggcatcaatcagttcaccagcatcttctgcctgacagtcatgagcatcgaccga
tacctggctgtggtccaccccatcaagtcggccaagtggaggagaccccggacggccaag
atgatcaccatggctgtgtggggagtctctctgctggtcatcttgcccatcatgatatat
gctgggctccggagcaaccagtgggggagaagcagctgcaccatcaactggccaggtgaa
tctggggcttggtacacagggttcatcatctacactttcattctggggttcctggtaccc
ctcaccatcatctgtctttgctacctgttcattatcatcaaggtgaagtcctctggaatc
cgagtgggctcctctaagaggaagaagtctgagaagaaggtcacccgaatggtgtccatc
gtggtggctgtcttcatcttctgctggcttcccttctacatattcaacgtttcttccgtc
tccatggccatcagccccaccccagcccttaaaggcatgtttgactttgtggtggtcctc
acctatgctaacagctgtgccaaccctatcctatatgccttcttgtctgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggagcgg
agtgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagacctccaaaccagtatctga

KEGG   Homo sapiens (human): 6753
Entry
6753              CDS       T01001                                 

Gene name
SSTR3, SS-3-R, SS3-R, SS3R, SSR-28
Definition
(RefSeq) somatostatin receptor 3
  KO
K04219  somatostatin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Drug target
Copper Cu 64 dotatate: D11882
Indium (111In) pentetreotide: D02108<JP/US>
Pasireotide (DG00503): D10147 D10497<US> D10566<JP/US>
Seglitide acetate: D05812
Somatostatin: D07431
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6753 (SSTR3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6753 (SSTR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6753 (SSTR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6753 (SSTR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw Rab5ip
Other DBs
NCBI-GeneID: 6753
NCBI-ProteinID: NP_001042
OMIM: 182453
HGNC: 11332
Ensembl: ENSG00000278195
Vega: OTTHUMG00000150537
Pharos: P32745(Tclin)
UniProt: P32745
LinkDB
Position
22q13.1
AA seq 418 aa
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggacatgcttcatccatcatcggtgtccacgacctcagaacctgagaatgcctcctcg
gcctggcccccagatgccaccctgggcaacgtgtcggcgggcccaagcccggcagggctg
gccgtcagtggcgttctgatccccctggtctacctggtggtgtgcgtggtgggcctgctg
ggtaactcgctggtcatctatgtggtcctgcggcacacggccagcccttcagtcaccaac
gtctacatcctcaacctggcgctggccgacgagctcttcatgctggggctgcccttcctg
gccgcccagaacgccctgtcctactggcccttcggctccctcatgtgccgcctggtcatg
gcggtggatggcatcaaccagttcaccagcatattctgcctgactgtcatgagcgtggac
cgctacctggccgtggtacatcccacccgctcggcccgctggcgcacagctccggtggcc
cgcacggtcagcgcggctgtgtgggtggcctcagccgtggtggtgctgcccgtggtggtc
ttctcgggagtgccccgcggcatgagcacctgccacatgcagtggcccgagccggcggcg
gcctggcgagccggcttcatcatctacacggccgcactgggcttcttcgggccgctgctg
gtcatctgcctctgctacctgctcatcgtggtgaaggtgcgctcagctgggcgccgggtg
tgggcaccctcgtgccagcggcggcggcgctccgaacgcagggtcacgcgcatggtggtg
gccgtggtggcgctcttcgtgctctgctggatgcccttctacgtgctcaacatcgtcaac
gtggtgtgcccactgcccgaggagcctgccttctttgggctctacttcctggtggtggcg
ctgccctatgccaacagctgtgccaaccccatcctttatggcttcctctcctaccgcttc
aagcagggcttccgcagggtcctgctgcggccctcccgccgtgtgcgcagccaggagccc
actgtggggcccccggagaagactgaggaggaggatgaggaggaggaggatggggaggag
agcagggaggggggcaaggggaaggagatgaacggccgggtcagccagatcacgcagcct
ggcaccagcgggcaggagcggccgcccagcagagtggccagcaaggagcagcagctccta
ccccaagaggcttccactggggagaagtccagcacgatgcgcatcagctacctgtag

KEGG   Homo sapiens (human): 6755
Entry
6755              CDS       T01001                                 

Gene name
SSTR5, SS-5-R
Definition
(RefSeq) somatostatin receptor 5
  KO
K04221  somatostatin receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Drug target
Copper Cu 64 dotatate: D11882
Indium (111In) pentetreotide: D02108<JP/US>
Lanreotide: D04666<JP/US>
Pasireotide (DG00503): D10147 D10497<US> D10566<JP/US>
Seglitide acetate: D05812
Somatostatin: D07431
Vapreotide (DG00502): D06281 D09988
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6755 (SSTR5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6755 (SSTR5)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6755 (SSTR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6755 (SSTR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6755 (SSTR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 6755
NCBI-ProteinID: NP_001044
OMIM: 182455
HGNC: 11334
Ensembl: ENSG00000162009
Vega: OTTHUMG00000047842
Pharos: P35346(Tclin)
UniProt: P35346
LinkDB
Position
16p13.3
AA seq 364 aa
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggagcccctgttcccagcctccacgcccagctggaacgcctcctccccgggggctgcc
tctggaggcggtgacaacaggacgctggtggggccggcgccctcggcaggggcccgggcg
gtgctggtgcccgtgctgtacctgctggtgtgtgcggccgggctgggcgggaacacgctg
gtcatctacgtggtgctgcgcttcgccaagatgaagaccgtcaccaacatctacattctc
aacctggcagtggccgacgtcctgtacatgctggggctgcctttcctggccacgcagaac
gccgcgtccttctggcccttcggccccgtcctgtgccgcctggtcatgacgctggacggc
gtcaaccagttcaccagtgtcttctgcctgacagtcatgagcgtggaccgctacctggca
gtggtgcacccgctgagctcggcccgctggcgccgcccgcgtgtggccaagctggcgagc
gccgcggcctgggtcctgtctctgtgcatgtcgctgccgctcctggtgttcgcggacgtg
caggagggcggtacctgcaacgccagctggccggagcccgtggggctgtggggcgccgtc
ttcatcatctacacggccgtgctgggcttcttcgcgccgctgctggtcatctgcctgtgc
tacctgctcatcgtggtgaaggtgagggcggcgggcgtgcgcgtgggctgcgtgcggcgg
cgctcggagcggaaggtgacgcgcatggtgttggtggtggtgctggtgtttgcgggatgt
tggctgcccttcttcaccgtcaacatcgtcaacctggccgtggcgctgccccaggagccc
gcctccgccggcctctacttcttcgtggtcatcctctcctacgccaacagctgtgccaac
cccgtcctctacggcttcctctctgacaacttccgccagagcttccagaaggttctgtgc
ctccgcaagggctctggtgccaaggacgctgacgccacggagccgcgtccagacaggatc
cggcagcagcaggaggccacgccacccgcgcaccgcgccgcagccaacgggcttatgcag
accagcaagctgtga

DBGET integrated database retrieval system