KEGG   Homo sapiens (human): 677Help
Entry
677               CDS       T01001                                 

Gene name
ZFP36L1, BRF1, Berg36, ERF-1, ERF1, RNF162B, TIS11B, cMG1
Definition
(RefSeq) ZFP36 ring finger protein like 1
  KO
K18753  butyrate response factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    677 (ZFP36L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    677 (ZFP36L1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     677 (ZFP36L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tis11B_N zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 677
NCBI-ProteinID: NP_001231627
OMIM: 601064
HGNC: 1107
Ensembl: ENSG00000185650
Vega: OTTHUMG00000171385
Pharos: Q07352(Tbio)
UniProt: Q07352 A0A024R658 B3KNA8
LinkDB All DBs
Position
14q24.1
AA seq 338 aa AA seqDB search
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccctcgtgtctgccaccatcttcgacttgagcgaagttttatgcaagggt
aacaagatgctcaactatagtgctcccagtgcagggggttgcctgctggacagaaaggca
gtgggcacccctgctggtgggggcttccctcggaggcactcagtcaccctgcccagctcc
aagttccaccagaaccagctcctcagcagcctcaagggtgagccagcccccgctctgagc
tcgcgagacagccgcttccgagaccgctccttctcggaagggggcgagcggctgctgccc
acccagaagcagcccgggggcggccaggtcaactccagccgctacaagacggagctgtgc
cgcccctttgaggaaaacggtgcctgtaagtacggggacaagtgccagttcgcacacggc
atccacgagctccgcagcctgacccgccaccccaagtacaagacggagctgtgccgcacc
ttccacaccatcggcttttgcccctacgggccccgctgccacttcatccacaacgctgaa
gagcgccgtgccctggccggggcccgggacctctccgctgaccgtccccgcctccagcat
agctttagctttgctgggtttcccagtgccgctgccaccgccgctgccaccgggctgctg
gacagccccacgtccatcaccccaccccctattctgagcgccgatgacctcctgggctca
cctaccctgcccgatggcaccaataacccttttgccttctccagccaggagctggcaagc
ctctttgcccctagcatggggctgcccgggggtggctccccgaccaccttcctcttccgg
cccatgtccgagtcccctcacatgtttgactctccccccagccctcaggattctctctcg
gaccaggagggctacctgagcagctccagcagcagccacagtggctcagactccccgacc
ttggacaactcaagacgcctgcccatcttcagcagactttccatctcagatgactaa

KEGG   Homo sapiens (human): 678Help
Entry
678               CDS       T01001                                 

Gene name
ZFP36L2, BRF2, ERF-2, ERF2, RNF162C, TIS11D
Definition
(RefSeq) ZFP36 ring finger protein like 2
  KO
K18753  butyrate response factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    678 (ZFP36L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    678 (ZFP36L2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     678 (ZFP36L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tis11B_N zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 678
NCBI-ProteinID: NP_008818
OMIM: 612053
HGNC: 1108
Ensembl: ENSG00000152518
Vega: OTTHUMG00000128642
Pharos: P47974(Tbio)
UniProt: P47974
LinkDB All DBs
Structure
PDB: 

Position
2p21
AA seq 494 aa AA seqDB search
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCAN
NAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPG
RRLPIFSRLSISDD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccacacttctgtccgccttctacgatgtcgacttcttgtgcaagacagagaaa
tccctggccaacctcaacctgaacaacatgctggacaagaaggcggtggggacgcctgtg
gccgccgcccccagctcgggcttcgcgccgggattcctccgacggcactcggccagcaac
ctgcatgcactcgcccaccccgcgcccagccccggcagctgctcgcccaagttcccgggc
gccgctaacggcagcagctgcggcagcgcggcggccggcggtccgacctcctacggcacc
cttaaggagccgtcggggggcggcggcacagccctgctcaacaaggagaacaaattccgg
gaccgctcgtttagcgagaacggcgatcgcagccagcacctcctgcacctgcagcagcag
cagaaggggggcggcggctcccagatcaactccacgcgctacaagaccgagctgtgccgg
cccttcgaggagagcggcacgtgcaagtacggcgaaaagtgccagttcgcgcatggcttc
cacgagctgcgcagcctgactcgccatccgaagtacaagaccgagctgtgccgcaccttt
cataccatcggcttctgcccctatgggccgcgctgccacttcatccacaacgcggacgag
cggcggcccgcgccgtcggggggcgcctccggggacctgcgtgcctttggcacgcgcgat
gcgttgcacctgggcttcccgcgggagccgcggcccaagttgcaccacagcctcagcttc
tcgggcttcccgtcgggccaccatcagcccccgggcggcctcgagtcgccgctgctgctc
gacagccccacgtcgcgcacgccgccgccgccctcctgctcttcggcctcgtcctgctcc
tcctccgcctcctcctgttcctcggcctccgcggcctccacgccctcgggcgccccgaca
tgctgcgcctccgcggcggccgcggctgcggccgctctgctgtacggcaccgggggcgcc
gaggacctgctggcgccgggggccccgtgcgcggcctgctcgtcggcctcgtgcgccaac
aacgccttcgccttcggtccggagctcagcagcctcatcacgccgctcgccatccagacc
cacaactttgccgccgtggccgccgccgcctactaccgcagtcagcagcagcagcagcag
cagggcctggcgccccccgcgcagccgccggcgccgcccagcgcgaccctccccgccggg
gccgccgcacctccctcgccgcccttcagcttccagctgccgcgccgcctgtccgactcg
cccgtgttcgacgcgccccccagccccccggactcgctgtcggaccgcgacagctaccta
agcggctccctgagctccggcagcctcagcggctctgagtctcccagcctcgaccctggc
cgccgcctgccaatcttcagccgcctctccatctccgacgactga

DBGET integrated database retrieval system