KEGG   Homo sapiens (human): 6777Help
Entry
6777              CDS       T01001                                 

Gene name
STAT5B, STAT5
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04917  Prolactin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00054  Duplication-activated FLT3 to Jak-STAT signaling pathway
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
N00267  HBV HBx to host-cell-protein activation
Disease
H00931  Growth hormone insensitivity with immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    6777 (STAT5B)
   04630 Jak-STAT signaling pathway
    6777 (STAT5B)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    6777 (STAT5B)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    6777 (STAT5B)
   04659 Th17 cell differentiation
    6777 (STAT5B)
   04062 Chemokine signaling pathway
    6777 (STAT5B)
  Endocrine system
   04917 Prolactin signaling pathway
    6777 (STAT5B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6777 (STAT5B)
   05203 Viral carcinogenesis
    6777 (STAT5B)
   05221 Acute myeloid leukemia
    6777 (STAT5B)
   05220 Chronic myeloid leukemia
    6777 (STAT5B)
   05223 Non-small cell lung cancer
    6777 (STAT5B)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6777 (STAT5B)
  Infectious diseases
   05166 HTLV-I infection
    6777 (STAT5B)
   05162 Measles
    6777 (STAT5B)
   05161 Hepatitis B
    6777 (STAT5B)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6777 (STAT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 6777
NCBI-ProteinID: NP_036580
OMIM: 604260
HGNC: 11367
Ensembl: ENSG00000173757
Vega: OTTHUMG00000150724
Pharos: P51692(Tchem)
UniProt: P51692
LinkDB All DBs
Position
17q21.2
AA seq 787 aa AA seqDB search
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttatatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcagtagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagccaacaatggtagctctccagctggaagccttgctgatgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacgcaggacacagagaat
gagttaaaaaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacgttcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgcgtcatggagtaccaccaagccacaggcacccttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcggtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacggcc
actgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtctgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctcctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagctgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgccgggggc
ggcagcgccacgtacatggaccaggccccctccccagctgtgtgtccccaggctcactat
aacatgtacccacagaaccctgactcagtccttgacaccgatggggacttcgatctggag
gacacaatggacgtagcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccgcacgcacaatcgtga

DBGET integrated database retrieval system