KEGG   Homo sapiens (human): 685
Entry
685               CDS       T01001                                 

Gene name
BTC
Definition
(RefSeq) betacellulin
  KO
K09783  betacellulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    685 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    685 (BTC)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   685 (BTC)
SSDB
Motif
Pfam: EGF Shisa Cadherin_C_2 Vpu LapA_dom Sigma_reg_N EphA2_TM TMEM154 Baculo_11_kDa TMEM52 Rhabdo_glycop TMEM100 DAG1 CD34_antigen DUF2663
Other DBs
NCBI-GeneID: 685
NCBI-ProteinID: NP_001720
OMIM: 600345
HGNC: 1121
Ensembl: ENSG00000174808
Vega: OTTHUMG00000130107
Pharos: P35070(Tbio)
UniProt: P35070 A0A0S2Z437
LinkDB
Structure
PDB: 
1IP0 1IOX

Position
4q13.3
AA seq 178 aa
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggaccgggccgcccggtgcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatccttcactgtgtggtggcagatgggaattccaccagaagtcctgaa
actaatggcctcctctgtggagaccctgaggaaaactgtgcagctaccaccacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcatcaaaggg
agatgccgcttcgtggtggccgagcagacgccctcctgtgtctgtgatgaaggctacatt
ggagcaaggtgtgagagagttgacttgttttacctaagaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggtcatcggtgtctgcaca
tgctgtcaccctcttcggaaacgtcgtaaaagaaagaagaaagaagaagaaatggaaact
ctgggtaaagatataactcctatcaatgaagatattgaagagacaaatattgcttaa

DBGET integrated database retrieval system