KEGG   Homo sapiens (human): 6854Help
Entry
6854              CDS       T01001                                 

Gene name
SYN2, SYNII
Definition
(RefSeq) synapsin II
  KO
K19941  synapsin
Organism
hsa  Homo sapiens (human)
Disease
H01649  Schizophrenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6854 (SYN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    6854 (SYN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synapsin_C Synapsin Synapsin_N LpxD
Motif
Other DBs
NCBI-GeneID: 6854
NCBI-ProteinID: NP_598328
OMIM: 600755
HGNC: 11495
Ensembl: ENSG00000157152
Vega: OTTHUMG00000155335
Pharos: Q92777(Tbio)
UniProt: Q92777 Q86VA8 B3KRB3
LinkDB All DBs
Position
3p25.2
AA seq 582 aa AA seqDB search
MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPPPPPGPGAASASAAPPTASPGPER
RPPPASAPAPQPAPTPSVGSSFFSSLSQAVKQTAASAGLVDAPAPAPAAARKAKVLLVVD
EPHADWAKCFRGKKVLGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRP
DFVLIRQHAFGMAENEDFRHLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLG
GEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT
YATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTC
SEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR
TPALSPQRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRRLPPG
PSLPPSSSSSSSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLAAPPQKPQPHPQLNKS
QSLTNAFSFSESSFFRSSANEDEAKAETIRSLRKSFASLFSD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcctgcggcgccggctgtcggacagcagcttcatcgccaacctgcccaac
ggctacatgaccgacctgcagcggcccgagccccagcagccgccgccgccgccgcccccc
ggtccgggcgccgcctcggcctcggcggcgcccccgaccgcctcgccgggcccggagcgg
aggccgccgcccgcctcggcgcccgcgccgcagcccgcgccgacgccgtcggtgggcagc
agcttcttcagctcgctgtcccaagccgtgaagcagacggccgcctcggctggcctggtg
gacgcgcccgctcccgcgcccgcagccgccaggaaggccaaggtgctgctggtggtcgac
gagccgcacgccgactgggccaagtgctttcggggcaaaaaagtccttggagattatgat
atcaaggtggaacaggcagaattttcagagctcaacctggtggcccatgcagatggcacc
tatgctgtggatatgcaggttctccggaatggcacaaaggttgtccggtccttccggcca
gacttcgtgctcatccggcagcatgcatttggcatggcggagaatgaggacttccgccac
ctgatcattggtatgcagtatgcaggcctccccagcatcaactcactggaatccatatac
aacttctgtgacaagccatgggtgtttgcccagctggtcgctatctataagacactggga
ggagaaaagttccctctcattgaacagacatactaccccaaccacaaagagatgctgaca
ctgcccacgttccctgtggtggtgaagattggccacgctcactcaggcatgggcaaggtc
aaagtggaaaaccactacgacttccaggacattgccagcgtggtggctctcacccagacc
tatgccactgcagagcctttcattgactccaagtatgacatccgggtccagaagattggc
aacaactacaaggcttacatgaggacatcgatctcagggaactggaagacgaacactggc
tctgcgatgctggagcagattgccatgtcagacaggtacaaactgtgggtggacacctgc
tctgagatgtttggcggcctggacatctgtgctgtcaaagctgtacatggcaaagatggg
aaagactacatttttgaggtcatggactgtagcatgccactgattggggaacatcaggtg
gaggacaggcaactcatcaccgaactagtcatcagcaagatgaaccagctgctgtccagg
actcctgccctgtctcctcagagacccctaacaacccagcagccacagagcggaacactt
aaggatccggactcaagcaagaccccacctcagcggccaccccctcaagggggccctggg
caaccccaaggaatgcagcccccaggcaaggtgctgcctccacgccggctcccccctgga
ccatcactgccaccttcctcctcttcctcctcttcttcctcctcctcggctcctcagcgg
ccgggcggccccaccacccacggagatgcaccctccagcagcagctccctggcagaggcc
cagccacccctggctgctccaccacagaagccccagcctcacccacagctcaacaagtcg
cagtccctgacaaatgccttcagcttctctgagtcctccttcttccggtcttcagccaat
gaggatgaagccaaagcagagaccatccggagcttgaggaagtcctttgccagcctcttt
tcagattag

DBGET integrated database retrieval system