KEGG   Homo sapiens (human): 6866
Entry
6866              CDS       T01001                                 

Gene name
TAC3, HH10, LncZBTB39, NK3, NKB, NKNB, PRO1155, ZNEUROK1
Definition
(RefSeq) tachykinin precursor 3
  KO
K05240  tachykinin 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00882  TAC3-TACR3-PLC-PKC signaling pathway
N00883  Mutation-inactivated TAC3 to TAC3-TACR3-PLC-PKC signaling pathway
N00884  Mutation-inactivated TACR3 to TAC3-TACR3-PLC-PKC signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6866 (TAC3)
SSDB
Motif
Pfam: Neurokinin_B TetR_C_20
Other DBs
NCBI-GeneID: 6866
NCBI-ProteinID: NP_037383
OMIM: 162330
HGNC: 11521
Ensembl: ENSG00000166863
Vega: OTTHUMG00000156958
Pharos: Q9UHF0(Tbio)
CPD: C16098
UniProt: Q9UHF0 A0A024RB47
LinkDB
Position
12q13.3
AA seq 121 aa
MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGL
LKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRA
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaggatcatgctgctattcacagccatcctggccttcagcctagctcagagctttggg
gctgtctgtaaggagccacaggaggaggtggttcctggcgggggccgcagcaagagggat
ccagatctctaccagctgctccagagactcttcaaaagccactcatctctggagggattg
ctcaaagccctgagccaggctagcacagatcctaaggaatcaacatctcccgagaaacgt
gacatgcatgacttctttgtgggacttatgggcaagaggagcgtccagccagactctcct
acggatgtgaatcaagagaacgtccccagctttggcatcctcaagtatcccccgagagca
gaatag

DBGET integrated database retrieval system