KEGG   Homo sapiens (human): 6886Help
Entry
6886              CDS       T01001                                 

Gene name
TAL1, SCL, TCL5, bHLHa17, tal-1
Definition
(RefSeq) TAL bHLH transcription factor 1, erythroid differentiation factor
  KO
K09068  T-cell acute lymphocytic leukemia protein
Organism
hsa  Homo sapiens (human)
Disease
H00002  T-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6886 (TAL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Lymphoid factors
    6886 (TAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH COE1_HLH SelK_SelG
Motif
Other DBs
NCBI-GeneID: 6886
NCBI-ProteinID: NP_001274276
OMIM: 187040
HGNC: 11556
Ensembl: ENSG00000162367
Vega: OTTHUMG00000007847
Pharos: P17542(Tbio)
UniProt: P17542 Q16509
LinkDB All DBs
Structure
PDB: 

Position
1p33
AA seq 331 aa AA seqDB search
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcggccgccgagcgaggcggctcgcagtgacccccagctagagggacgggac
gcggccgaggccagcatggcccccccgcacctggtcctgctgaacggcgtcgccaaggag
acgagccgcgcggccgcagcggagcccccagtcatcgaactgggcgcgcgcggaggcccg
gggggcggccctgccggtgggggcggcgccgcgagagacttaaagggccgcgacgcggcg
acggccgaagcgcgccatcgggtgcccaccaccgagctgtgcagacctcccgggcccgcc
ccggcccccgcgcccgcctcggttacagcggagctgcccggcgacggccgcatggtgcag
ctgagtcctcccgcgctggctgcccccgccgcccccggccgcgcgctgctctacagcctc
agccagccgctggcctctctcggcagcgggttctttggggagccggatgccttccctatg
ttcaccaccaacaatcgagtgaagaggagaccttccccctatgagatggagattactgat
ggtccccacaccaaagttgtgcggcgtatcttcaccaacagccgggagcgatggcggcag
cagaatgtgaacggggcctttgccgagctccgcaagctgatccccacacatcccccggac
aagaagctcagcaagaatgagatcctccgcctggccatgaagtatatcaacttcttggcc
aagctgctcaatgaccaggaggaggagggcacccagcgggccaagactggcaaggaccct
gtggtgggggctggtgggggtggaggtgggggagggggcggcgcgcccccagatgacctc
ctgcaagacgtgctttcccccaactccagctgcggcagctccctggatggggcagccagc
ccggacagctacacggaggagcccgcgcccaagcacacggcccgcagcctccatcctgcc
atgctgcctgccgccgatggagccggccctcggtga

DBGET integrated database retrieval system