KEGG   Homo sapiens (human): 6890Help
Entry
6890              CDS       T01001                                 

Gene name
TAP1, ABC17, ABCB2, APT1, D6S114E, PSF-1, PSF1, RING4, TAP1*0102N, TAP1N
Definition
(RefSeq) transporter 1, ATP binding cassette subfamily B member
  KO
K05653  ATP-binding cassette, subfamily B (MDR/TAP), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05340  Primary immunodeficiency
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00093  Combined immunodeficiency
H00984  Bare lymphocyte syndrome type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    6890 (TAP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    6890 (TAP1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    6890 (TAP1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    6890 (TAP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6890 (TAP1)
   05168 Herpes simplex virus 1 infection
    6890 (TAP1)
   05163 Human cytomegalovirus infection
    6890 (TAP1)
   05169 Epstein-Barr virus infection
    6890 (TAP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6890 (TAP1)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    6890 (TAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA_29 AAA_23 ABC_ATPase AAA_21 AAA_15 AAA_25 AAA_30 AAA_33 SRP54
Motif
Other DBs
NCBI-GeneID: 6890
NCBI-ProteinID: NP_000584
OMIM: 170260
HGNC: 43
Ensembl: ENSG00000168394
Vega: OTTHUMG00000031067
Pharos: Q03518(Tbio)
UniProt: Q03518 A0A0S2Z5A6
LinkDB All DBs
Structure
PDB: 

Position
6p21.32
AA seq 808 aa AA seqDB search
MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVP
MASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAV
GLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWG
APGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCL
GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV
LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLS
ENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL
AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGM
LLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFE
YLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN
GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIA
YGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRK
PCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAI
REGGTHQQLMEKKGCYWAMVQAPADAPE
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcttctcgccagcgcaggatcagcctgttcctgggactttccgagagccccg
ccctcgttccctcccccagccgccagtaggggaggactcggcggtacccggagcttcagg
ccccaccggggcgcggagagtcccaggcccggccgggaccgggacggcgtccgagtgcca
atggctagctctaggtgtcccgctccccgcgggtgccgctgcctccccggagcttctctc
gcatggctggggacagtactgctacttctcgccgactgggtgctgctccggaccgcgctg
ccccgcatattctccctgctggtgcccaccgcgctgccactgctccgggtctgggcggtg
ggcctgagccgctgggccgtgctctggctgggggcctgcggggtcctcagggcaacggtt
ggctccaagagcgaaaacgcaggtgcccagggctggctggctgctttgaagccattagct
gcggcactgggcttggccctgccgggacttgccttgttccgagagctgatctcatgggga
gcccccgggtccgcggatagcaccaggctactgcactggggaagtcaccctaccgccttc
gttgtcagttatgcagcggcactgcccgcagcagccctgtggcacaaactcgggagcctc
tgggtgcccggcggtcagggcggctctggaaaccctgtgcgtcggcttctaggctgcctg
ggctcggagacgcgccgcctctcgctgttcctggtcctggtggtcctctcctctcttggg
gagatggccattccattctttacgggccgcctcactgactggattctacaagatggctca
gccgataccttcactcgaaacttaactctcatgtccattctcaccatagccagtgcagtg
ctggagttcgtgggtgacgggatctataacaacaccatgggccacgtgcacagccacttg
cagggagaggtgtttggggctgtcctgcgccaggagacggagtttttccaacagaaccag
acaggtaacatcatgtctcgggtaacagaggacacgtccaccctgagtgattctctgagt
gagaatctgagcttatttctgtggtacctggtgcgaggcctatgtctcttggggatcatg
ctctggggatcagtgtccctcaccatggtcaccctgatcaccctgcctctgcttttcctt
ctgcccaagaaggtgggaaaatggtaccagttgctggaagtgcaggtgcgggaatctctg
gcaaagtccagccaggtggccattgaggctctgtcggccatgcctacagttcgaagcttt
gccaacgaggagggcgaagcccagaagtttagggaaaagctgcaagaaataaagacactc
aaccagaaggaggctgtggcctatgcagtcaactcctggaccactagtatttcaggtatg
ctgctgaaagtgggaatcctctacattggtgggcagctggtgaccagtggggctgtaagc
agtgggaaccttgtcacatttgttctctaccagatgcagttcacccaggctgtggaggta
ctgctctccatctaccccagagtacagaaggctgtgggctcctcagagaaaatatttgag
tacctggaccgcacccctcgctgcccacccagtggtctgttgactcccttacacttggag
ggccttgtccagttccaagatgtctcctttgcctacccaaaccgcccagatgtcttagtg
ctacaggggctgacattcaccctacgccctggcgaggtgacggcgctggtgggacccaat
gggtctgggaagagcacagtggctgccctgctgcagaatctgtaccagcccaccggggga
cagctgctgttggatgggaagccccttccccaatatgagcaccgctacctgcacaggcag
gtggctgcagtgggacaagagccacaggtatttggaagaagtcttcaagaaaatattgcc
tatggcctgacccagaagccaactatggaggaaatcacagctgctgcagtaaagtctggg
gcccatagtttcatctctggactccctcagggctatgacacagaggtagacgaggctggg
agccagctgtcagggggtcagcgacaggcagtggcgttggcccgagcattgatccggaaa
ccgtgtgtacttatcctggatgatgccaccagtgccctggatgcaaacagccagttacag
gtggagcagctcctgtacgaaagccctgagcggtactcccgctcagtgcttctcatcacc
cagcacctcagcctggtggagcaggctgaccacatcctctttctggaaggaggcgctatc
cgggaggggggaacccaccagcagctcatggagaaaaaggggtgctactgggccatggtg
caggctcctgcagatgctccagaatga

KEGG   Homo sapiens (human): 6891Help
Entry
6891              CDS       T01001                                 

Gene name
TAP2, ABC18, ABCB3, APT2, D6S217E, PSF-2, PSF2, RING11
Definition
(RefSeq) transporter 2, ATP binding cassette subfamily B member
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05340  Primary immunodeficiency
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00093  Combined immunodeficiency
H00984  Bare lymphocyte syndrome type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    6891 (TAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    6891 (TAP2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    6891 (TAP2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    6891 (TAP2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6891 (TAP2)
   05168 Herpes simplex virus 1 infection
    6891 (TAP2)
   05163 Human cytomegalovirus infection
    6891 (TAP2)
   05169 Epstein-Barr virus infection
    6891 (TAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6891 (TAP2)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    6891 (TAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_30 AAA_22 AAA_16 AAA_29 AAA_25 AAA_21 AAA_15 AAA_23 AAA_33 SRP54 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 6891
NCBI-ProteinID: NP_001276972
OMIM: 170261
HGNC: 44
Ensembl: ENSG00000204267
Vega: OTTHUMG00000031068
Pharos: Q03519(Tbio)
UniProt: Q03519 Q5JNW1
LinkDB All DBs
Structure
PDB: 

Position
6p21.32
AA seq 686 aa AA seqDB search
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLG
FVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLS
PPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL
GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM
PFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE
QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV
GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIA
HRLQTVQRAHQILVLQEGKLQKLAQL
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccctgacctgagaccctggacctccctgctgctggtggacgcggctttactg
tggctgcttcagggccctctggggactttgcttcctcaagggctgccaggactatggctg
gaggggaccctgcggctgggagggctgtgggggctgctaaagctaagagggctgctggga
tttgtggggacactgctgctcccgctctgtctggccacccccctgactgtctccctgaga
gccctggtcgcgggggcctcacgtgctcccccagccagagtcgcttcagccccttggagc
tggctgctggtggggtacggggctgcggggctcagctggtcactgtgggctgttctgagc
cctcctggagcccaggagaaggagcaggaccaggtgaacaacaaagtcttgatgtggagg
ctgctgaagctctccaggccggacctgcctctcctcgttgccgccttcttcttccttgtc
cttgctgttttgggtgagacattaatccctcactattctggtcgtgtgattgacatcctg
ggaggtgattttgacccccatgcctttgccagtgccatcttcttcatgtgcctcttctcc
tttggcagctcactgtctgcaggctgccgaggaggctgcttcacctacaccatgtctcga
atcaacttgcggatccgggagcagcttttctcctccctgctgcgccaggacctcggtttc
ttccaggagactaagacaggggagctgaactcacggctgagctcggataccaccctgatg
agtaactggcttcctttaaatgccaatgtgctcttgcgaagcctggtgaaagtggtgggg
ctgtatggcttcatgctcagcatatcgcctcgactcaccctcctttctctgctgcacatg
cccttcacaatagcagcggagaaggtgtacaacacccgccatcaggaagtgcttcgggag
atccaggatgcagtggccagggcggggcaggtggtgcgggaagccgttggagggctgcag
accgttcgcagttttggggccgaggagcatgaagtctgtcgctataaagaggcccttgaa
caatgtcggcagctgtattggcggagagacctggaacgcgccttgtacctgctcgtaagg
agggtgctgcacttgggggtgcagatgctgatgctgagctgtgggctgcagcagatgcag
gatggggagctcacccagggcagcctgctttcctttatgatctaccaggagagcgtgggg
agctatgtgcagaccctggtatacatatatggggatatgctcagcaacgtgggagctgca
gagaaggttttctcctacatggaccgacagccaaatctgccttcacctggcacgcttgcc
cccaccactctgcagggggttgtgaaattccaagacgtctcctttgcatatcccaatcgc
cctgacaggcctgtgctcaaggggctgacgtttaccctacgtcctggtgaggtgacggcg
ctggtgggacccaatgggtctgggaagagcacagtggctgccctgctgcagaatctgtac
cagcccacagggggacaggtgctgctggatgaaaagcccatctcacagtatgaacactgc
tacctgcacagccaggtggtttcagttgggcaggagcctgtgctgttctccggttctgtg
aggaacaacattgcttatgggctgcagagctgcgaagatgataaggtgatggcggctgcc
caggctgcccacgcagatgacttcatccaggaaatggagcatggaatatacacagatgta
ggggagaagggaagccagctggctgcgggacagaaacaacgtctggccattgcccgggcc
cttgtacgagacccgcgggtcctcatcctggatgaggctactagtgccctagatgtgcag
tgcgagcaggccctgcaggactggaattcccgtggggatcgcacagtgctggtgattgct
cacaggctgcagacagttcagcgcgcccaccagatcctggtgctccaggagggcaagctg
cagaagcttgcccagctctag

DBGET integrated database retrieval system