KEGG   Homo sapiens (human): 6892Help
Entry
6892              CDS       T01001                                 

Gene name
TAPBP, NGS17, TAPA, TPN, TPSN
Definition
(RefSeq) TAP binding protein
  KO
K08058  TAP binding protein (tapasin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06129  MHC presentation (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00984  Bare lymphocyte syndrome type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    6892 (TAPBP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6892 (TAPBP)
   05168 Herpes simplex virus 1 infection
    6892 (TAPBP)
   05163 Human cytomegalovirus infection
    6892 (TAPBP)
   05169 Epstein-Barr virus infection
    6892 (TAPBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3
Motif
Other DBs
NCBI-GeneID: 6892
NCBI-ProteinID: NP_003181
OMIM: 601962
HGNC: 11566
Ensembl: ENSG00000231925
Vega: OTTHUMG00000031090
Pharos: O15533(Tbio)
UniProt: O15533 A0A024RCT1
LinkDB All DBs
Structure
PDB: 

Position
6p21.32
AA seq 448 aa AA seqDB search
MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDL
DPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD
GAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDL
SFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAA
WDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPAT
LARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSV
SLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA
FLLLGLFKALGWAAVYLSTCKDSKKKAE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctgtctctgctcctcgctgtggctttgggcctggcgaccgccgtctcagca
ggacccgcggtgatcgagtgttggttcgtggaggatgcgagcggaaagggcctggccaag
agacccggtgcactgctgttgcgccagggaccgggggaaccgccgccccggccggacctc
gaccctgagctctatctcagtgtacacgaccccgcgggcgccctccaggctgccttcagg
cggtatccccggggcgcccccgcaccacactgcgagatgagccgcttcgtgcctctcccc
gcctctgcgaaatgggccagcggcctgacccccgcgcagaactgcccgcgggccctggat
ggggcttggctgatggtcagcatatccagcccagtcctcagcctctccagcctcttgcga
ccacagccagagcctcagcaggagcctgttctcatcaccatggcaacagtggtactgact
gtcctcacccacacccctgcccctcgagtgagactgggacaagatgctctgctggacttg
agctttgcctacatgccccccacctccgaggccgcctcatctctggctccgggtccccct
ccctttgggctagagtggcgacgccagcacctgggtaagggacatctgctcctggctgca
actcctgggctgaatggccagatgccagcagcccaagaaggggccgtggcatttgctgct
tgggatgatgatgagccatggggcccatggaccggaaatgggaccttctggctgcctaca
gttcaaccctttcaggagggcacctatctggccaccatacacctgccatacctgcaagga
caggtcaccctggagcttgctgtgtacaaaccccccaaagtgtccctgatgccagcaacc
cttgcacgggccgccccaggggaggcacccccggaattgctctgccttgtgtcccacttc
tacccttctgggggcctggaggtggagtgggaactccggggtggcccagggggccgctct
cagaaggccgaggggcagaggtggctctcggccctgcgccaccattccgatggctctgtc
agcctctctgggcacttgcagccgcccccagtcaccactgagcagcatggggcacgctat
gcctgtcgaattcaccatcccagcctgcctgcctcggggcgcagcgctgaggtcaccctg
gaggtagcaggtctttcagggccctcccttgaggacagcgtaggccttttcctgtctgcc
tttcttctgcttgggctcttcaaggcactgggctgggctgctgtctacctgtccacctgc
aaggattcaaagaagaaagcagagtga

DBGET integrated database retrieval system